Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2270191..2270897 | Replicon | chromosome |
Accession | NZ_CP114549 | ||
Organism | Xylella fastidiosa subsp. pauca strain ALM4 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | Q9PAL4 |
Locus tag | O4444_RS10280 | Protein ID | WP_010894925.1 |
Coordinates | 2270191..2270493 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | O4444_RS10285 | Protein ID | WP_060872143.1 |
Coordinates | 2270496..2270897 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4444_RS10255 (O4444_10255) | 2265349..2266527 | - | 1179 | WP_023907007.1 | phage tail sheath family protein | - |
O4444_RS10260 (O4444_10260) | 2266592..2268184 | - | 1593 | WP_282459574.1 | hypothetical protein | - |
O4444_RS10265 (O4444_10265) | 2268192..2268749 | - | 558 | WP_282459575.1 | phage tail protein I | - |
O4444_RS10270 (O4444_10270) | 2268742..2269635 | - | 894 | WP_023907762.1 | baseplate J/gp47 family protein | - |
O4444_RS10275 (O4444_10275) | 2269635..2269997 | - | 363 | WP_233242664.1 | GPW/gp25 family protein | - |
O4444_RS10280 (O4444_10280) | 2270191..2270493 | + | 303 | WP_010894925.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
O4444_RS10285 (O4444_10285) | 2270496..2270897 | + | 402 | WP_060872143.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
O4444_RS10290 (O4444_10290) | 2270966..2271553 | - | 588 | WP_088372104.1 | phage baseplate assembly protein V | - |
O4444_RS10295 (O4444_10295) | 2271550..2272092 | - | 543 | WP_023907017.1 | hypothetical protein | - |
O4444_RS10300 (O4444_10300) | 2272068..2272589 | - | 522 | WP_010893241.1 | hypothetical protein | - |
O4444_RS10305 (O4444_10305) | 2272586..2272909 | - | 324 | WP_042462902.1 | hypothetical protein | - |
O4444_RS10310 (O4444_10310) | 2272909..2273169 | - | 261 | WP_010893239.1 | hypothetical protein | - |
O4444_RS10315 (O4444_10315) | 2273187..2275067 | - | 1881 | WP_088372102.1 | phage major capsid protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2259642..2302475 | 42833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10958.74 Da Isoelectric Point: 8.0251
>T266694 WP_010894925.1 NZ_CP114549:2270191-2270493 [Xylella fastidiosa subsp. pauca]
MEKGTPHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
MEKGTPHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
Download Length: 303 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 15004.12 Da Isoelectric Point: 7.1650
>AT266694 WP_060872143.1 NZ_CP114549:2270496-2270897 [Xylella fastidiosa subsp. pauca]
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSF
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSF
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|