Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 733458..734233 | Replicon | chromosome |
Accession | NZ_CP114375 | ||
Organism | Klebsiella pneumoniae strain KP6870155 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | NOZ09_RS03640 | Protein ID | WP_021314147.1 |
Coordinates | 733748..734233 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NOZ09_RS03635 | Protein ID | WP_004150912.1 |
Coordinates | 733458..733751 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOZ09_RS03615 (728666) | 728666..729268 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
NOZ09_RS03620 (729366) | 729366..730277 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NOZ09_RS03625 (730278) | 730278..731426 | - | 1149 | WP_032417597.1 | PLP-dependent aspartate aminotransferase family protein | - |
NOZ09_RS03630 (731437) | 731437..732813 | - | 1377 | WP_073553579.1 | cystathionine beta-synthase | - |
NOZ09_RS03635 (733458) | 733458..733751 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NOZ09_RS03640 (733748) | 733748..734233 | + | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
NOZ09_RS03645 (734937) | 734937..735530 | + | 594 | WP_004188553.1 | hypothetical protein | - |
NOZ09_RS03650 (735627) | 735627..735843 | + | 217 | Protein_717 | transposase | - |
NOZ09_RS03660 (736358) | 736358..737071 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 735627..735779 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T266642 WP_021314147.1 NZ_CP114375:733748-734233 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |