Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 363371..364017 | Replicon | chromosome |
| Accession | NZ_CP114375 | ||
| Organism | Klebsiella pneumoniae strain KP6870155 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A231WWF9 |
| Locus tag | NOZ09_RS01690 | Protein ID | WP_004174016.1 |
| Coordinates | 363371..363718 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4S7L580 |
| Locus tag | NOZ09_RS01695 | Protein ID | WP_019725405.1 |
| Coordinates | 363718..364017 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOZ09_RS01680 (359297) | 359297..360730 | + | 1434 | WP_032445350.1 | glycogen synthase GlgA | - |
| NOZ09_RS01685 (360748) | 360748..363195 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| NOZ09_RS01690 (363371) | 363371..363718 | + | 348 | WP_004174016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NOZ09_RS01695 (363718) | 363718..364017 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
| NOZ09_RS01700 (364080) | 364080..365588 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| NOZ09_RS01705 (365793) | 365793..366122 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| NOZ09_RS01710 (366173) | 366173..367003 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| NOZ09_RS01715 (367053) | 367053..367811 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13518.55 Da Isoelectric Point: 6.2327
>T266641 WP_004174016.1 NZ_CP114375:363371-363718 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A231WWF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7L580 |