Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5467647..5468242 | Replicon | chromosome |
| Accession | NZ_CP114374 | ||
| Organism | Pseudomonas aeruginosa strain Jade-X | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | O2604_RS25675 | Protein ID | WP_003113526.1 |
| Coordinates | 5467964..5468242 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | O2604_RS25670 | Protein ID | WP_003111575.1 |
| Coordinates | 5467647..5467952 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2604_RS25645 (O2604_25645) | 5463619..5464233 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| O2604_RS25650 (O2604_25650) | 5464275..5464859 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| O2604_RS25655 (O2604_25655) | 5464900..5466000 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| O2604_RS25670 (O2604_25670) | 5467647..5467952 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| O2604_RS25675 (O2604_25675) | 5467964..5468242 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O2604_RS25680 (O2604_25680) | 5468295..5468423 | - | 129 | Protein_5070 | integrase | - |
| O2604_RS25685 (O2604_25685) | 5468571..5470799 | + | 2229 | WP_034021308.1 | TonB-dependent receptor | - |
| O2604_RS25690 (O2604_25690) | 5470869..5471516 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| O2604_RS25695 (O2604_25695) | 5471578..5472816 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T266639 WP_003113526.1 NZ_CP114374:c5468242-5467964 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |