Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4853057..4853738 | Replicon | chromosome |
| Accession | NZ_CP114374 | ||
| Organism | Pseudomonas aeruginosa strain Jade-X | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | O2604_RS22865 | Protein ID | WP_096255097.1 |
| Coordinates | 4853373..4853738 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1C7BMJ2 |
| Locus tag | O2604_RS22860 | Protein ID | WP_003159602.1 |
| Coordinates | 4853057..4853380 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2604_RS22835 (O2604_22835) | 4848330..4849271 | - | 942 | WP_003085798.1 | alpha/beta hydrolase | - |
| O2604_RS22840 (O2604_22840) | 4849380..4850063 | - | 684 | WP_124715685.1 | TetR/AcrR family transcriptional regulator | - |
| O2604_RS22845 (O2604_22845) | 4850151..4851029 | + | 879 | WP_023120826.1 | hypothetical protein | - |
| O2604_RS22855 (O2604_22855) | 4851813..4852975 | + | 1163 | WP_149586497.1 | IS3-like element IS222 family transposase | - |
| O2604_RS22860 (O2604_22860) | 4853057..4853380 | - | 324 | WP_003159602.1 | XRE family transcriptional regulator | Antitoxin |
| O2604_RS22865 (O2604_22865) | 4853373..4853738 | - | 366 | WP_096255097.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O2604_RS22870 (O2604_22870) | 4854031..4854273 | - | 243 | WP_042115131.1 | hypothetical protein | - |
| O2604_RS22875 (O2604_22875) | 4854480..4854752 | + | 273 | WP_003085667.1 | hypothetical protein | - |
| O2604_RS22880 (O2604_22880) | 4854771..4855196 | - | 426 | WP_003114206.1 | VOC family protein | - |
| O2604_RS22885 (O2604_22885) | 4855297..4856181 | + | 885 | WP_009875989.1 | LysR family transcriptional regulator | - |
| O2604_RS22890 (O2604_22890) | 4856154..4857107 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
| O2604_RS22895 (O2604_22895) | 4857328..4857762 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13897.27 Da Isoelectric Point: 4.7017
>T266638 WP_096255097.1 NZ_CP114374:c4853738-4853373 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHLHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELDVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHLHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELDVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|