Detailed information of TA system TA266629

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 35013..35282
• Replicon: plasmid unnamed3
• Accession: NZ_CP114364
• Organism: Klebsiella variicola strain 2022CK-00568

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OPU52_RS29320
• Protein ID: WP_001372321.1
• Coordinates: 35157..35282 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	35013..35078 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OPU52_RS29290	30723..31250	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OPU52_RS29295	31308..31541	+	234	WP_000006003.1	DUF905 family protein	-
OPU52_RS29300	31602..33625	+	2024	Protein_41	ParB/RepB/Spo0J family partition protein	-
OPU52_RS29305	33694..34128	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OPU52_RS29310	34125..34844	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	34856..35080	+	225	NuclAT_0	-	-
-	34856..35080	+	225	NuclAT_0	-	-
-	34856..35080	+	225	NuclAT_0	-	-
-	34856..35080	+	225	NuclAT_0	-	-
-	35013..35078	-	66	-	-	Antitoxin
OPU52_RS29315	35066..35215	+	150	Protein_44	plasmid maintenance protein Mok	-
OPU52_RS29320	35157..35282	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OPU52_RS29325	35601..35897	-	297	Protein_46	hypothetical protein	-
OPU52_RS29330	36197..36493	+	297	WP_001272251.1	hypothetical protein	-
OPU52_RS29335	36604..37425	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OPU52_RS29340	37722..38312	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
OPU52_RS29345	38647..39030	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OPU52_RS29350	39224..39895	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
OPU52_RS29355	40032..40259	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T266629 WP_001372321.1 NZ_CP114364:35157-35282 [Klebsiella variicola]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT266629 NZ_CP114364:c35078-35013 [Klebsiella variicola]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin