Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 4165832..4166429 | Replicon | chromosome |
| Accession | NZ_CP114361 | ||
| Organism | Klebsiella variicola strain 2022CK-00568 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0B7GEF2 |
| Locus tag | OPU52_RS20290 | Protein ID | WP_012542526.1 |
| Coordinates | 4166112..4166429 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OPU52_RS20285 | Protein ID | WP_012542525.1 |
| Coordinates | 4165832..4166119 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPU52_RS20255 (OPU52_20250) | 4161736..4161984 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
| OPU52_RS20260 (OPU52_20255) | 4162001..4162342 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| OPU52_RS20265 (OPU52_20260) | 4162373..4163488 | - | 1116 | WP_162823038.1 | MBL fold metallo-hydrolase | - |
| OPU52_RS20270 (OPU52_20265) | 4163668..4164249 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
| OPU52_RS20275 (OPU52_20270) | 4164249..4164617 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
| OPU52_RS20280 (OPU52_20275) | 4164737..4165390 | + | 654 | WP_032729541.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| OPU52_RS20285 (OPU52_20280) | 4165832..4166119 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OPU52_RS20290 (OPU52_20285) | 4166112..4166429 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OPU52_RS20295 (OPU52_20290) | 4166614..4167657 | - | 1044 | WP_269136554.1 | DUF2157 domain-containing protein | - |
| OPU52_RS20300 (OPU52_20295) | 4168122..4168988 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
| OPU52_RS20305 (OPU52_20300) | 4169097..4170524 | + | 1428 | WP_023297179.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12092.35 Da Isoelectric Point: 11.2767
>T266621 WP_012542526.1 NZ_CP114361:c4166429-4166112 [Klebsiella variicola]
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|