Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 368554..369200 | Replicon | chromosome |
Accession | NZ_CP114361 | ||
Organism | Klebsiella variicola strain 2022CK-00568 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2V3KK24 |
Locus tag | OPU52_RS01685 | Protein ID | WP_032731351.1 |
Coordinates | 368554..368901 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1F2LZT5 |
Locus tag | OPU52_RS01690 | Protein ID | WP_008806992.1 |
Coordinates | 368901..369200 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPU52_RS01675 (OPU52_01675) | 364441..365874 | + | 1434 | WP_004202133.1 | glycogen synthase GlgA | - |
OPU52_RS01680 (OPU52_01680) | 365892..368339 | + | 2448 | WP_048268278.1 | glycogen phosphorylase | - |
OPU52_RS01685 (OPU52_01685) | 368554..368901 | + | 348 | WP_032731351.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OPU52_RS01690 (OPU52_01690) | 368901..369200 | + | 300 | WP_008806992.1 | XRE family transcriptional regulator | Antitoxin |
OPU52_RS01695 (OPU52_01695) | 369263..370771 | - | 1509 | WP_032740278.1 | glycerol-3-phosphate dehydrogenase | - |
OPU52_RS01700 (OPU52_01700) | 370976..371305 | + | 330 | WP_004202138.1 | thiosulfate sulfurtransferase GlpE | - |
OPU52_RS01705 (OPU52_01705) | 371356..372186 | + | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
OPU52_RS01710 (OPU52_01710) | 372236..372994 | + | 759 | WP_008806995.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13474.43 Da Isoelectric Point: 6.2327
>T266611 WP_032731351.1 NZ_CP114361:368554-368901 [Klebsiella variicola]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V3KK24 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LZT5 |