Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 1287..1884 | Replicon | plasmid unnamed4 |
Accession | NZ_CP114358 | ||
Organism | Klebsiella variicola strain 2022CK-00567 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0B7GEF2 |
Locus tag | OPU51_RS29325 | Protein ID | WP_012542526.1 |
Coordinates | 1287..1604 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OPU51_RS29330 | Protein ID | WP_012542525.1 |
Coordinates | 1597..1884 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPU51_RS29320 (OPU51_29320) | 59..1102 | + | 1044 | WP_269136554.1 | DUF2157 domain-containing protein | - |
OPU51_RS29325 (OPU51_29325) | 1287..1604 | + | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OPU51_RS29330 (OPU51_29330) | 1597..1884 | + | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OPU51_RS29335 (OPU51_29335) | 2326..2979 | - | 654 | WP_032729541.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OPU51_RS29340 (OPU51_29340) | 3099..3467 | - | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
OPU51_RS29345 (OPU51_29345) | 3467..4048 | - | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
OPU51_RS29350 (OPU51_29350) | 4228..5343 | + | 1116 | WP_162823038.1 | MBL fold metallo-hydrolase | - |
OPU51_RS29355 (OPU51_29355) | 5374..5715 | + | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
OPU51_RS29360 (OPU51_29360) | 5732..5980 | - | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..33141 | 33141 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12092.35 Da Isoelectric Point: 11.2767
>T266608 WP_012542526.1 NZ_CP114358:1287-1604 [Klebsiella variicola]
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|