Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13599..14256 Replicon plasmid unnamed2
Accession NZ_CP114356
Organism Klebsiella variicola strain 2022CK-00567

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag OPU51_RS28210 Protein ID WP_000270043.1
Coordinates 13906..14256 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OPU51_RS28205 Protein ID WP_000124640.1
Coordinates 13599..13901 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPU51_RS28155 (OPU51_28155) 9233..9661 + 429 WP_000591076.1 hypothetical protein -
OPU51_RS28160 (OPU51_28160) 9719..10078 + 360 WP_000422769.1 hypothetical protein -
OPU51_RS28165 (OPU51_28165) 10078..10524 + 447 WP_000919343.1 hypothetical protein -
OPU51_RS28170 (OPU51_28170) 10521..11039 + 519 WP_000210757.1 nitrite reductase -
OPU51_RS28175 (OPU51_28175) 11039..11269 + 231 WP_000972665.1 hypothetical protein -
OPU51_RS28180 (OPU51_28180) 11256..12113 + 858 WP_001167036.1 hypothetical protein -
OPU51_RS28185 (OPU51_28185) 12139..12330 + 192 WP_001270409.1 hypothetical protein -
OPU51_RS28190 (OPU51_28190) 12333..12860 + 528 WP_004201083.1 thermonuclease family protein -
OPU51_RS28195 (OPU51_28195) 12918..13190 + 273 WP_001043046.1 HU family DNA-binding protein -
OPU51_RS28200 (OPU51_28200) 13279..13572 + 294 WP_001239998.1 hypothetical protein -
OPU51_RS28205 (OPU51_28205) 13599..13901 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
OPU51_RS28210 (OPU51_28210) 13906..14256 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OPU51_RS28215 (OPU51_28215) 14419..14967 + 549 WP_001061573.1 hypothetical protein -
OPU51_RS28220 (OPU51_28220) 15308..15502 + 195 WP_000343597.1 hypothetical protein -
OPU51_RS28225 (OPU51_28225) 15513..15884 + 372 WP_000516918.1 hypothetical protein -
OPU51_RS28230 (OPU51_28230) 15877..16347 + 471 WP_001281821.1 hypothetical protein -
OPU51_RS28235 (OPU51_28235) 16362..16697 - 336 WP_000683477.1 hypothetical protein -
OPU51_RS28240 (OPU51_28240) 16794..17282 + 489 WP_001273096.1 DUF1643 domain-containing protein -
OPU51_RS28245 (OPU51_28245) 17285..17782 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCMY-6 / aac(6')-Ib / blaNDM-4 / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr htpB 1..137756 137756


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T266607 WP_000270043.1 NZ_CP114356:c14256-13906 [Klebsiella variicola]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT266607 WP_000124640.1 NZ_CP114356:c13901-13599 [Klebsiella variicola]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References