Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4164633..4165230 | Replicon | chromosome |
Accession | NZ_CP114332 | ||
Organism | Klebsiella variicola strain 2022CK-00505 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0B7GEF2 |
Locus tag | OGU18_RS20285 | Protein ID | WP_012542526.1 |
Coordinates | 4164913..4165230 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OGU18_RS20280 | Protein ID | WP_012542525.1 |
Coordinates | 4164633..4164920 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGU18_RS20250 (OGU18_20245) | 4160537..4160785 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
OGU18_RS20255 (OGU18_20250) | 4160802..4161143 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
OGU18_RS20260 (OGU18_20255) | 4161174..4162289 | - | 1116 | WP_162823038.1 | MBL fold metallo-hydrolase | - |
OGU18_RS20265 (OGU18_20260) | 4162469..4163050 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
OGU18_RS20270 (OGU18_20265) | 4163050..4163418 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
OGU18_RS20275 (OGU18_20270) | 4163538..4164191 | + | 654 | WP_032729541.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OGU18_RS20280 (OGU18_20275) | 4164633..4164920 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OGU18_RS20285 (OGU18_20280) | 4164913..4165230 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGU18_RS20290 (OGU18_20285) | 4165415..4166458 | - | 1044 | WP_269136554.1 | DUF2157 domain-containing protein | - |
OGU18_RS20295 (OGU18_20290) | 4166923..4167789 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
OGU18_RS20300 (OGU18_20295) | 4167898..4169325 | + | 1428 | WP_023297179.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12092.35 Da Isoelectric Point: 11.2767
>T266583 WP_012542526.1 NZ_CP114332:c4165230-4164913 [Klebsiella variicola]
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|