Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 831852..832036 | Replicon | chromosome |
Accession | NC_017342 | ||
Organism | Staphylococcus aureus subsp. aureus TCH60 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | HMPREF0772_RS03975 | Protein ID | WP_000482647.1 |
Coordinates | 831852..831959 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 831976..832036 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HMPREF0772_RS03950 | 827214..827687 | + | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
HMPREF0772_RS03955 | 827810..829021 | - | 1212 | WP_001191920.1 | multidrug effflux MFS transporter | - |
HMPREF0772_RS03960 | 829203..829862 | - | 660 | WP_000831298.1 | membrane protein | - |
HMPREF0772_RS03965 | 829922..831064 | - | 1143 | WP_001176856.1 | glycerate kinase | - |
HMPREF0772_RS03970 | 831332..831718 | + | 387 | WP_000779351.1 | flippase GtxA | - |
HMPREF0772_RS03975 | 831852..831959 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 831976..832036 | - | 61 | - | - | Antitoxin |
HMPREF0772_RS03985 | 832607..834370 | + | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
HMPREF0772_RS03990 | 834395..836128 | + | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
HMPREF0772_RS04000 | 836359..836526 | + | 168 | Protein_754 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T26658 WP_000482647.1 NC_017342:831852-831959 [Staphylococcus aureus subsp. aureus TCH60]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T26658 NC_017342:831852-831959 [Staphylococcus aureus subsp. aureus TCH60]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT26658 NC_017342:c832036-831976 [Staphylococcus aureus subsp. aureus TCH60]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|