Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 368555..369201 | Replicon | chromosome |
Accession | NZ_CP114328 | ||
Organism | Klebsiella variicola strain 2022CK-00504 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2V3KK24 |
Locus tag | OEE49_RS01685 | Protein ID | WP_032731351.1 |
Coordinates | 368555..368902 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1F2LZT5 |
Locus tag | OEE49_RS01690 | Protein ID | WP_008806992.1 |
Coordinates | 368902..369201 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEE49_RS01675 (OEE49_01675) | 364442..365875 | + | 1434 | WP_004202133.1 | glycogen synthase GlgA | - |
OEE49_RS01680 (OEE49_01680) | 365893..368340 | + | 2448 | WP_048268278.1 | glycogen phosphorylase | - |
OEE49_RS01685 (OEE49_01685) | 368555..368902 | + | 348 | WP_032731351.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEE49_RS01690 (OEE49_01690) | 368902..369201 | + | 300 | WP_008806992.1 | XRE family transcriptional regulator | Antitoxin |
OEE49_RS01695 (OEE49_01695) | 369264..370772 | - | 1509 | WP_032740278.1 | glycerol-3-phosphate dehydrogenase | - |
OEE49_RS01700 (OEE49_01700) | 370977..371306 | + | 330 | WP_004202138.1 | thiosulfate sulfurtransferase GlpE | - |
OEE49_RS01705 (OEE49_01705) | 371357..372187 | + | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
OEE49_RS01710 (OEE49_01710) | 372237..372995 | + | 759 | WP_008806995.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13474.43 Da Isoelectric Point: 6.2327
>T266554 WP_032731351.1 NZ_CP114328:368555-368902 [Klebsiella variicola]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V3KK24 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LZT5 |