Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2588959..2589143 | Replicon | chromosome |
Accession | NC_017341 | ||
Organism | Staphylococcus aureus subsp. aureus str. JKD6008 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | SAA6008_RS13490 | Protein ID | WP_000482650.1 |
Coordinates | 2589036..2589143 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2588959..2589019 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAA6008_RS13465 | 2584489..2584656 | - | 168 | WP_001790576.1 | hypothetical protein | - |
SAA6008_RS13475 | 2584887..2586620 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
SAA6008_RS13480 | 2586645..2588408 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2588959..2589019 | + | 61 | - | - | Antitoxin |
SAA6008_RS13490 | 2589036..2589143 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAA6008_RS13495 | 2589276..2589662 | - | 387 | WP_000779358.1 | flippase GtxA | - |
SAA6008_RS13500 | 2589930..2591072 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAA6008_RS13505 | 2591132..2591791 | + | 660 | WP_000831298.1 | membrane protein | - |
SAA6008_RS13510 | 2591973..2593184 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAA6008_RS13515 | 2593307..2593780 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T26654 WP_000482650.1 NC_017341:c2589143-2589036 [Staphylococcus aureus subsp. aureus str. JKD6008]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T26654 NC_017341:c2589143-2589036 [Staphylococcus aureus subsp. aureus str. JKD6008]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT26654 NC_017341:2588959-2589019 [Staphylococcus aureus subsp. aureus str. JKD6008]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|