266466

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 15232..15889 Replicon plasmid unnamed1
Accession NZ_CP114306
Organism Klebsiella oxytoca strain 2022CK-00498

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag OGU21_RS27265 Protein ID WP_000270043.1
Coordinates 15539..15889 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OGU21_RS27260 Protein ID WP_000124640.1
Coordinates 15232..15534 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGU21_RS27215 (OGU21_27215) 10857..11285 + 429 WP_000591074.1 hypothetical protein -
OGU21_RS27220 (OGU21_27220) 11342..11701 + 360 WP_000422768.1 hypothetical protein -
OGU21_RS27225 (OGU21_27225) 11701..12147 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
OGU21_RS27230 (OGU21_27230) 12144..12662 + 519 WP_000210756.1 nitrite reductase -
OGU21_RS27235 (OGU21_27235) 12662..12892 + 231 WP_000972663.1 hypothetical protein -
OGU21_RS27240 (OGU21_27240) 12879..13736 + 858 WP_001167032.1 hypothetical protein -
OGU21_RS27245 (OGU21_27245) 13967..14494 + 528 WP_001236377.1 thermonuclease family protein -
OGU21_RS27250 (OGU21_27250) 14552..14824 + 273 WP_001043047.1 HU family DNA-binding protein -
OGU21_RS27255 (OGU21_27255) 14912..15205 + 294 WP_001239997.1 chromosome segregation protein ParM -
OGU21_RS27260 (OGU21_27260) 15232..15534 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
OGU21_RS27265 (OGU21_27265) 15539..15889 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OGU21_RS27270 (OGU21_27270) 16052..16600 + 549 WP_001061574.1 transcriptional regulator -
OGU21_RS27275 (OGU21_27275) 16941..17069 + 129 Protein_25 hypothetical protein -
OGU21_RS27280 (OGU21_27280) 17150..17905 - 756 WP_269776967.1 IS21-like element ISAs28 family helper ATPase IstB -
OGU21_RS27285 (OGU21_27285) 17929..19491 - 1563 WP_269776966.1 IS21 family transposase -
OGU21_RS27290 (OGU21_27290) 19698..19766 + 69 Protein_28 hypothetical protein -
OGU21_RS27295 (OGU21_27295) 19777..20148 + 372 WP_000516916.1 hypothetical protein -
OGU21_RS27300 (OGU21_27300) 20141..20611 + 471 WP_001281821.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / blaTEM-52B / sul1 / blaKPC-3 / qnrB89 / qacE / aadA2 / ant(2'')-Ia / aph(3')-Ia / mph(A) - 1..189110 189110


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T266466 WP_000270043.1 NZ_CP114306:c15889-15539 [Klebsiella oxytoca]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT266466 WP_000124640.1 NZ_CP114306:c15534-15232 [Klebsiella oxytoca]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References