Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 149893..150553 | Replicon | chromosome |
Accession | NZ_CP114281 | ||
Organism | Gallibacterium anatis strain ESV200 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A3A103 |
Locus tag | CF557_RS00830 | Protein ID | WP_052124504.1 |
Coordinates | 150194..150553 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0A2ZWF9 |
Locus tag | CF557_RS00825 | Protein ID | WP_039163779.1 |
Coordinates | 149893..150192 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CF557_RS00800 (CF557_00800) | 145161..146234 | + | 1074 | WP_094873102.1 | DUF3383 family protein | - |
CF557_RS00805 (CF557_00805) | 146286..146711 | + | 426 | WP_039163784.1 | DUF3277 family protein | - |
CF557_RS00810 (CF557_00810) | 146711..147196 | + | 486 | WP_094873099.1 | hypothetical protein | - |
CF557_RS00815 (CF557_00815) | 147232..147384 | + | 153 | WP_017805951.1 | hypothetical protein | - |
CF557_RS00820 (CF557_00820) | 147381..149855 | + | 2475 | WP_094873096.1 | tape measure protein | - |
CF557_RS00825 (CF557_00825) | 149893..150192 | - | 300 | WP_039163779.1 | helix-turn-helix transcriptional regulator | Antitoxin |
CF557_RS00830 (CF557_00830) | 150194..150553 | - | 360 | WP_052124504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CF557_RS00835 (CF557_00835) | 150619..151197 | + | 579 | WP_094873093.1 | hypothetical protein | - |
CF557_RS00840 (CF557_00840) | 151197..151529 | + | 333 | WP_017805944.1 | hypothetical protein | - |
CF557_RS00845 (CF557_00845) | 151507..152472 | + | 966 | WP_094873090.1 | hypothetical protein | - |
CF557_RS00850 (CF557_00850) | 152465..153136 | + | 672 | WP_094873088.1 | Gp138 family membrane-puncturing spike protein | - |
CF557_RS00855 (CF557_00855) | 153133..153498 | + | 366 | WP_017805941.1 | hypothetical protein | - |
CF557_RS00860 (CF557_00860) | 153491..154927 | + | 1437 | WP_094873085.1 | baseplate J/gp47 family protein | - |
CF557_RS00865 (CF557_00865) | 154936..155550 | + | 615 | WP_094873082.1 | DUF2612 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 112587..158897 | 46310 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13592.72 Da Isoelectric Point: 9.4530
>T266445 WP_052124504.1 NZ_CP114281:c150553-150194 [Gallibacterium anatis]
MAVNHQWNILFTDCFSKWLDQQDIPTKKSVAAALNLLKITGPELSRPYADTIKGSQYPNMKELRIQHQGKPLRAFFAFDP
LRQAIVLCAGDKSNDKQFYKRMIALADTEFAAYLANLEK
MAVNHQWNILFTDCFSKWLDQQDIPTKKSVAAALNLLKITGPELSRPYADTIKGSQYPNMKELRIQHQGKPLRAFFAFDP
LRQAIVLCAGDKSNDKQFYKRMIALADTEFAAYLANLEK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A3A103 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2ZWF9 |