Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3571584..3572278 | Replicon | chromosome |
| Accession | NZ_CP114280 | ||
| Organism | Dickeya lacustris strain LMG30899 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | E0SCS6 |
| Locus tag | O1Q98_RS16115 | Protein ID | WP_013319142.1 |
| Coordinates | 3571874..3572278 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | O1Q98_RS16110 | Protein ID | WP_125259776.1 |
| Coordinates | 3571584..3571877 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q98_RS16090 (O1Q98_16095) | 3567225..3567554 | + | 330 | WP_015854059.1 | HGGxSTG domain-containing protein | - |
| O1Q98_RS16095 (O1Q98_16100) | 3567944..3568978 | + | 1035 | WP_125259773.1 | hypothetical protein | - |
| O1Q98_RS16100 (O1Q98_16105) | 3568978..3570003 | + | 1026 | WP_125259774.1 | DUF262 domain-containing protein | - |
| O1Q98_RS16105 (O1Q98_16110) | 3570859..3571476 | + | 618 | WP_125259775.1 | hypothetical protein | - |
| O1Q98_RS16110 (O1Q98_16115) | 3571584..3571877 | + | 294 | WP_125259776.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| O1Q98_RS16115 (O1Q98_16120) | 3571874..3572278 | + | 405 | WP_013319142.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| O1Q98_RS16125 (O1Q98_16130) | 3573903..3574976 | + | 1074 | WP_125260204.1 | hypothetical protein | - |
| O1Q98_RS16130 (O1Q98_16135) | 3575820..3576056 | + | 237 | WP_038923672.1 | AlpA family phage regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3561656..3600343 | 38687 | |
| - | flank | IS/Tn | - | - | 3573183..3573521 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15477.77 Da Isoelectric Point: 7.0609
>T266442 WP_013319142.1 NZ_CP114280:3571874-3572278 [Dickeya lacustris]
MSIRIFKSTLIRQQLSPQELDDLVADFLSYKKEGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGASDPDAYLLIIILKPEAHKMARNNNHMHKIGVMAEAFRMKY
MSIRIFKSTLIRQQLSPQELDDLVADFLSYKKEGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGASDPDAYLLIIILKPEAHKMARNNNHMHKIGVMAEAFRMKY
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|