Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2119897..2120196 | Replicon | chromosome |
| Accession | NC_017341 | ||
| Organism | Staphylococcus aureus subsp. aureus str. JKD6008 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | SAA6008_RS15775 | Protein ID | WP_072482930.1 |
| Coordinates | 2120020..2120196 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2119897..2119952 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAA6008_RS10760 | 2116420..2116986 | + | 567 | WP_001807342.1 | multidrug-binding transcriptional regulator QacR | - |
| SAA6008_RS10765 | 2117119..2117304 | - | 186 | WP_000797248.1 | helix-turn-helix transcriptional regulator | - |
| SAA6008_RS10770 | 2117309..2117647 | - | 339 | WP_001049146.1 | hypothetical protein | - |
| SAA6008_RS10775 | 2117893..2118501 | - | 609 | WP_000583528.1 | recombinase family protein | - |
| SAA6008_RS10780 | 2118784..2119047 | + | 264 | WP_000495112.1 | DUF4238 domain-containing protein | - |
| SAA6008_RS10785 | 2119077..2119751 | + | 675 | WP_001106019.1 | IS6-like element IS257 family transposase | - |
| SAA6008_RS10790 | 2119860..2119967 | + | 108 | Protein_2053 | hypothetical protein | - |
| - | 2119889..2120028 | + | 140 | NuclAT_0 | - | - |
| - | 2119889..2120028 | + | 140 | NuclAT_0 | - | - |
| - | 2119889..2120028 | + | 140 | NuclAT_0 | - | - |
| - | 2119889..2120028 | + | 140 | NuclAT_0 | - | - |
| - | 2119897..2119952 | + | 56 | - | - | Antitoxin |
| SAA6008_RS15775 | 2120020..2120196 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| SAA6008_RS10800 | 2120305..2121078 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| SAA6008_RS10805 | 2121451..2121825 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| SAA6008_RS10810 | 2121881..2122168 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| SAA6008_RS10815 | 2122214..2122366 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sea / hlb / groEL | 2117119..2175154 | 58035 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T26643 WP_072482930.1 NC_017341:c2120196-2120020 [Staphylococcus aureus subsp. aureus str. JKD6008]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T26643 NC_017341:c2120196-2120020 [Staphylococcus aureus subsp. aureus str. JKD6008]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT26643 NC_017341:2119897-2119952 [Staphylococcus aureus subsp. aureus str. JKD6008]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|