Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 348997..349672 | Replicon | chromosome |
| Accession | NZ_CP114201 | ||
| Organism | Delftia acidovorans strain BIM B-1761 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | F6AKY9 |
| Locus tag | O1V13_RS01540 | Protein ID | WP_013800178.1 |
| Coordinates | 348997..349380 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | F6AKZ0 |
| Locus tag | O1V13_RS01545 | Protein ID | WP_013800179.1 |
| Coordinates | 349361..349672 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1V13_RS01525 (O1V13_01525) | 346301..347032 | + | 732 | WP_013800176.1 | TorF family putative porin | - |
| O1V13_RS01530 (O1V13_01530) | 347056..347394 | + | 339 | WP_012202241.1 | P-II family nitrogen regulator | - |
| O1V13_RS01535 (O1V13_01535) | 347426..348799 | + | 1374 | WP_170962109.1 | ammonium transporter | - |
| O1V13_RS01540 (O1V13_01540) | 348997..349380 | + | 384 | WP_013800178.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O1V13_RS01545 (O1V13_01545) | 349361..349672 | + | 312 | WP_013800179.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| O1V13_RS01550 (O1V13_01550) | 349809..350963 | + | 1155 | WP_269197960.1 | glycolate oxidase subunit GlcE | - |
| O1V13_RS01555 (O1V13_01555) | 350989..351771 | + | 783 | WP_012202244.1 | YoaK family protein | - |
| O1V13_RS01560 (O1V13_01560) | 351833..353083 | + | 1251 | WP_269197961.1 | glycolate oxidase subunit GlcF | - |
| O1V13_RS01565 (O1V13_01565) | 353168..354034 | + | 867 | WP_034397802.1 | ProQ/FinO family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14752.44 Da Isoelectric Point: 5.2260
>T266420 WP_013800178.1 NZ_CP114201:348997-349380 [Delftia acidovorans]
MTQPWEVEYTDELGDWWADLTQAEQESIDASVRLLEARGPNLGYPHTSGIGRSRHPHMRELRVQHEGRPYRLLYAFDPRR
CAILLIGGDKTGDGRWYEVHVPIADRLYDTHLETLQKEGRIDGQEIQ
MTQPWEVEYTDELGDWWADLTQAEQESIDASVRLLEARGPNLGYPHTSGIGRSRHPHMRELRVQHEGRPYRLLYAFDPRR
CAILLIGGDKTGDGRWYEVHVPIADRLYDTHLETLQKEGRIDGQEIQ
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A031HZS7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A031I0J9 |