Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 4867135..4867658 | Replicon | chromosome |
Accession | NZ_CP114190 | ||
Organism | Aminobacter sp. NyZ550 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | N7E70_RS24180 | Protein ID | WP_055978267.1 |
Coordinates | 4867135..4867407 (-) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | N7E70_RS24185 | Protein ID | WP_263007870.1 |
Coordinates | 4867407..4867658 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E70_RS24165 (N7E70_024160) | 4862429..4864207 | - | 1779 | WP_263007867.1 | acyl-CoA dehydrogenase | - |
N7E70_RS24170 (N7E70_024165) | 4864535..4865731 | + | 1197 | WP_263007868.1 | GH25 family lysozyme | - |
N7E70_RS24175 (N7E70_024170) | 4865747..4867024 | - | 1278 | WP_263007869.1 | phosphoribosylamine--glycine ligase | - |
N7E70_RS24180 (N7E70_024175) | 4867135..4867407 | - | 273 | WP_055978267.1 | Txe/YoeB family addiction module toxin | Toxin |
N7E70_RS24185 (N7E70_024180) | 4867407..4867658 | - | 252 | WP_263007870.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
N7E70_RS24190 (N7E70_024185) | 4867760..4868743 | + | 984 | WP_263007871.1 | 4-hydroxybenzoate octaprenyltransferase | - |
N7E70_RS24195 (N7E70_024190) | 4868744..4869310 | - | 567 | WP_055978260.1 | DUF6101 family protein | - |
N7E70_RS24200 (N7E70_024195) | 4869479..4870909 | - | 1431 | WP_263007872.1 | FAD-binding oxidoreductase | - |
N7E70_RS24205 (N7E70_024200) | 4870925..4871893 | - | 969 | WP_263007873.1 | L-threonylcarbamoyladenylate synthase | - |
N7E70_RS24210 (N7E70_024205) | 4872064..4872456 | + | 393 | WP_263007874.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10540.95 Da Isoelectric Point: 9.4955
>T266414 WP_055978267.1 NZ_CP114190:c4867407-4867135 [Aminobacter sp. NyZ550]
MRIIFSEASWSDYLFWQQADKAVCDRINELIKDARRSPFVGIGKPEPLSGNYSGFWSRRITREHRLVYRVTGKGDAQALE
IAACRYHYDR
MRIIFSEASWSDYLFWQQADKAVCDRINELIKDARRSPFVGIGKPEPLSGNYSGFWSRRITREHRLVYRVTGKGDAQALE
IAACRYHYDR
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|