Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 13599..14256 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP114170 | ||
| Organism | Klebsiella variicola strain 2022CK-00565 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | OIX89_RS28350 | Protein ID | WP_000270043.1 |
| Coordinates | 13906..14256 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OIX89_RS28345 | Protein ID | WP_000124640.1 |
| Coordinates | 13599..13901 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIX89_RS28295 (OIX89_28295) | 9233..9661 | + | 429 | WP_000591076.1 | hypothetical protein | - |
| OIX89_RS28300 (OIX89_28300) | 9719..10078 | + | 360 | WP_000422769.1 | hypothetical protein | - |
| OIX89_RS28305 (OIX89_28305) | 10078..10524 | + | 447 | WP_000919343.1 | hypothetical protein | - |
| OIX89_RS28310 (OIX89_28310) | 10521..11039 | + | 519 | WP_000210757.1 | nitrite reductase | - |
| OIX89_RS28315 (OIX89_28315) | 11039..11269 | + | 231 | WP_000972665.1 | hypothetical protein | - |
| OIX89_RS28320 (OIX89_28320) | 11256..12113 | + | 858 | WP_001167036.1 | hypothetical protein | - |
| OIX89_RS28325 (OIX89_28325) | 12139..12330 | + | 192 | WP_001270409.1 | hypothetical protein | - |
| OIX89_RS28330 (OIX89_28330) | 12333..12860 | + | 528 | WP_004201083.1 | thermonuclease family protein | - |
| OIX89_RS28335 (OIX89_28335) | 12918..13190 | + | 273 | WP_001043046.1 | HU family DNA-binding protein | - |
| OIX89_RS28340 (OIX89_28340) | 13279..13572 | + | 294 | WP_001239998.1 | hypothetical protein | - |
| OIX89_RS28345 (OIX89_28345) | 13599..13901 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| OIX89_RS28350 (OIX89_28350) | 13906..14256 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OIX89_RS28355 (OIX89_28355) | 14419..14967 | + | 549 | WP_001061573.1 | hypothetical protein | - |
| OIX89_RS28360 (OIX89_28360) | 15308..15502 | + | 195 | WP_000343597.1 | hypothetical protein | - |
| OIX89_RS28365 (OIX89_28365) | 15513..15884 | + | 372 | WP_000516918.1 | hypothetical protein | - |
| OIX89_RS28370 (OIX89_28370) | 15877..16347 | + | 471 | WP_001281821.1 | hypothetical protein | - |
| OIX89_RS28375 (OIX89_28375) | 16362..16697 | - | 336 | WP_000683477.1 | hypothetical protein | - |
| OIX89_RS28380 (OIX89_28380) | 16794..17282 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| OIX89_RS28385 (OIX89_28385) | 17285..17782 | + | 498 | WP_000062185.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-6 / aac(6')-Ib / blaNDM-4 / mph(A) / sul1 / qacE / qnrB6 / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr | htpB | 1..157867 | 157867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T266405 WP_000270043.1 NZ_CP114170:c14256-13906 [Klebsiella variicola]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|