Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1913885..1914067 | Replicon | chromosome |
| Accession | NC_017341 | ||
| Organism | Staphylococcus aureus subsp. aureus str. JKD6008 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAA6008_RS16090 | Protein ID | WP_001801861.1 |
| Coordinates | 1913885..1913980 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1914008..1914067 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAA6008_RS09390 | 1909545..1910171 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| SAA6008_RS09395 | 1910212..1910556 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| SAA6008_RS09400 | 1910654..1911205 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| SAA6008_RS09405 | 1911423..1912064 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SAA6008_RS09410 | 1912178..1912363 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| SAA6008_RS09415 | 1912365..1912541 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SAA6008_RS09420 | 1912552..1912935 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SAA6008_RS09430 | 1913539..1913682 | - | 144 | WP_001549059.1 | transposase | - |
| SAA6008_RS16090 | 1913885..1913980 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1914008..1914067 | - | 60 | - | - | Antitoxin |
| SAA6008_RS09435 | 1914103..1914204 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SAA6008_RS15665 | 1914182..1914358 | - | 177 | Protein_1822 | transposase | - |
| SAA6008_RS09440 | 1914552..1914929 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| SAA6008_RS09445 | 1915450..1916679 | - | 1230 | Protein_1824 | ATP-binding protein | - |
| SAA6008_RS09450 | 1916781..1917953 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| SAA6008_RS15675 | 1918006..1918182 | + | 177 | Protein_1826 | DUF1829 domain-containing protein | - |
| SAA6008_RS15680 | 1918643..1918851 | + | 209 | Protein_1827 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1916781..1917953 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26640 WP_001801861.1 NC_017341:1913885-1913980 [Staphylococcus aureus subsp. aureus str. JKD6008]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26640 NC_017341:1913885-1913980 [Staphylococcus aureus subsp. aureus str. JKD6008]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT26640 NC_017341:c1914067-1914008 [Staphylococcus aureus subsp. aureus str. JKD6008]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|