Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1997137..1997783 | Replicon | chromosome |
| Accession | NZ_CP114168 | ||
| Organism | Klebsiella variicola strain 2022CK-00565 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2V3KK24 |
| Locus tag | OIX89_RS09405 | Protein ID | WP_032731351.1 |
| Coordinates | 1997137..1997484 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1F2LZT5 |
| Locus tag | OIX89_RS09410 | Protein ID | WP_008806992.1 |
| Coordinates | 1997484..1997783 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIX89_RS09395 (OIX89_09395) | 1993024..1994457 | + | 1434 | WP_004202133.1 | glycogen synthase GlgA | - |
| OIX89_RS09400 (OIX89_09400) | 1994475..1996922 | + | 2448 | WP_048268278.1 | glycogen phosphorylase | - |
| OIX89_RS09405 (OIX89_09405) | 1997137..1997484 | + | 348 | WP_032731351.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OIX89_RS09410 (OIX89_09410) | 1997484..1997783 | + | 300 | WP_008806992.1 | XRE family transcriptional regulator | Antitoxin |
| OIX89_RS09415 (OIX89_09415) | 1997846..1999354 | - | 1509 | WP_032740278.1 | glycerol-3-phosphate dehydrogenase | - |
| OIX89_RS09420 (OIX89_09420) | 1999559..1999888 | + | 330 | WP_004202138.1 | thiosulfate sulfurtransferase GlpE | - |
| OIX89_RS09425 (OIX89_09425) | 1999939..2000769 | + | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
| OIX89_RS09430 (OIX89_09430) | 2000819..2001577 | + | 759 | WP_008806995.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13474.43 Da Isoelectric Point: 6.2327
>T266393 WP_032731351.1 NZ_CP114168:1997137-1997484 [Klebsiella variicola]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V3KK24 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZT5 |