Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 225578..226175 | Replicon | chromosome |
Accession | NZ_CP114168 | ||
Organism | Klebsiella variicola strain 2022CK-00565 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0B7GEF2 |
Locus tag | OIX89_RS01090 | Protein ID | WP_012542526.1 |
Coordinates | 225858..226175 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OIX89_RS01085 | Protein ID | WP_012542525.1 |
Coordinates | 225578..225865 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIX89_RS01055 (OIX89_01055) | 221482..221730 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
OIX89_RS01060 (OIX89_01060) | 221747..222088 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
OIX89_RS01065 (OIX89_01065) | 222119..223234 | - | 1116 | WP_162823038.1 | MBL fold metallo-hydrolase | - |
OIX89_RS01070 (OIX89_01070) | 223414..223995 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
OIX89_RS01075 (OIX89_01075) | 223995..224363 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
OIX89_RS01080 (OIX89_01080) | 224483..225136 | + | 654 | WP_032729541.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OIX89_RS01085 (OIX89_01085) | 225578..225865 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OIX89_RS01090 (OIX89_01090) | 225858..226175 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OIX89_RS01095 (OIX89_01095) | 226360..227403 | - | 1044 | WP_269136554.1 | DUF2157 domain-containing protein | - |
OIX89_RS01100 (OIX89_01100) | 227868..228734 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
OIX89_RS01105 (OIX89_01105) | 228843..230270 | + | 1428 | WP_023297179.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12092.35 Da Isoelectric Point: 11.2767
>T266387 WP_012542526.1 NZ_CP114168:c226175-225858 [Klebsiella variicola]
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|