Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 157293..158017 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP114161 | ||
| Organism | Klebsiella quasipneumoniae strain 2022CK-00516 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A6B7Q840 |
| Locus tag | N5B28_RS26635 | Protein ID | WP_065905253.1 |
| Coordinates | 157706..158017 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5B28_RS26630 | Protein ID | WP_049010942.1 |
| Coordinates | 157293..157709 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5B28_RS26600 (N5B28_26600) | 152602..153198 | - | 597 | WP_009309883.1 | fertility inhibition protein FinO | - |
| N5B28_RS26605 (N5B28_26605) | 153317..154297 | + | 981 | WP_023155665.1 | IS5-like element ISKpn26 family transposase | - |
| N5B28_RS26610 (N5B28_26610) | 154486..155319 | - | 834 | WP_065905247.1 | N-6 DNA methylase | - |
| N5B28_RS26615 (N5B28_26615) | 155366..155596 | - | 231 | WP_065905248.1 | hypothetical protein | - |
| N5B28_RS26620 (N5B28_26620) | 155685..156032 | - | 348 | WP_023292162.1 | hypothetical protein | - |
| N5B28_RS26625 (N5B28_26625) | 156098..156478 | - | 381 | WP_065905249.1 | hypothetical protein | - |
| N5B28_RS26630 (N5B28_26630) | 157293..157709 | - | 417 | WP_049010942.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N5B28_RS26635 (N5B28_26635) | 157706..158017 | - | 312 | WP_065905253.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N5B28_RS26640 (N5B28_26640) | 158124..158348 | - | 225 | WP_049157091.1 | hypothetical protein | - |
| N5B28_RS26645 (N5B28_26645) | 158359..158571 | - | 213 | WP_065905255.1 | hypothetical protein | - |
| N5B28_RS26650 (N5B28_26650) | 158632..158961 | - | 330 | WP_074439645.1 | hypothetical protein | - |
| N5B28_RS26655 (N5B28_26655) | 158958..159194 | - | 237 | WP_227524536.1 | single-stranded DNA-binding protein | - |
| N5B28_RS26660 (N5B28_26660) | 159746..159808 | - | 63 | Protein_175 | hypothetical protein | - |
| N5B28_RS26665 (N5B28_26665) | 159823..160173 | - | 351 | WP_047722605.1 | hypothetical protein | - |
| N5B28_RS26670 (N5B28_26670) | 160170..160442 | - | 273 | WP_065905257.1 | hypothetical protein | - |
| N5B28_RS26675 (N5B28_26675) | 160632..161117 | + | 486 | WP_065905260.1 | cytoplasmic protein | - |
| N5B28_RS26680 (N5B28_26680) | 161357..161473 | - | 117 | WP_223176086.1 | type I toxin-antitoxin system Hok family toxin | - |
| N5B28_RS26685 (N5B28_26685) | 161421..161573 | - | 153 | WP_224230667.1 | DUF5431 family protein | - |
| N5B28_RS26690 (N5B28_26690) | 161732..162058 | - | 327 | WP_038992719.1 | hypothetical protein | - |
| N5B28_RS26695 (N5B28_26695) | 162055..162783 | - | 729 | WP_040107916.1 | plasmid SOS inhibition protein A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..175750 | 175750 | |
| - | flank | IS/Tn | - | - | 153317..154297 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12525.37 Da Isoelectric Point: 9.9242
>T266366 WP_065905253.1 NZ_CP114161:c158017-157706 [Klebsiella quasipneumoniae]
VHVISRAPFDEAARHYPNDAVAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
VHVISRAPFDEAARHYPNDAVAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15438.52 Da Isoelectric Point: 4.4711
>AT266366 WP_049010942.1 NZ_CP114161:c157709-157293 [Klebsiella quasipneumoniae]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHDPDSPLVDMLTARIDAWEDNAVEFEEFNTRIEAGKNGV
SLLRVLMQQHGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHDPDSPLVDMLTARIDAWEDNAVEFEEFNTRIEAGKNGV
SLLRVLMQQHGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|