Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1788987..1789647 | Replicon | chromosome |
Accession | NZ_CP114160 | ||
Organism | Klebsiella quasipneumoniae strain 2022CK-00516 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5B28_RS08660 | Protein ID | WP_072413417.1 |
Coordinates | 1789294..1789647 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5B28_RS08655 | Protein ID | WP_072413418.1 |
Coordinates | 1788987..1789289 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5B28_RS08630 (1784193) | 1784193..1785296 | - | 1104 | WP_130953023.1 | AarF/UbiB family protein | - |
N5B28_RS08640 (1785819) | 1785819..1787255 | + | 1437 | WP_032456343.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
N5B28_RS08650 (1787619) | 1787619..1788551 | + | 933 | Protein_1687 | integrase arm-type DNA-binding domain-containing protein | - |
N5B28_RS08655 (1788987) | 1788987..1789289 | - | 303 | WP_072413418.1 | XRE family transcriptional regulator | Antitoxin |
N5B28_RS08660 (1789294) | 1789294..1789647 | - | 354 | WP_072413417.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5B28_RS08665 (1790145) | 1790145..1790366 | - | 222 | WP_047738806.1 | helix-turn-helix transcriptional regulator | - |
N5B28_RS08670 (1790363) | 1790363..1790824 | - | 462 | WP_049004530.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13500.41 Da Isoelectric Point: 9.5699
>T266356 WP_072413417.1 NZ_CP114160:c1789647-1789294 [Klebsiella quasipneumoniae]
MWTIKTTDTFDRWFASLSDTDRVSMLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGDPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
MWTIKTTDTFDRWFASLSDTDRVSMLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGDPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|