Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4069005..4069595 | Replicon | chromosome |
Accession | NZ_CP114134 | ||
Organism | Xanthomonas fragariae strain YLX21 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A2N7V9W3 |
Locus tag | OZ429_RS19275 | Protein ID | WP_016902142.1 |
Coordinates | 4069314..4069595 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | A0A1A9MEX2 |
Locus tag | OZ429_RS19270 | Protein ID | WP_064507888.1 |
Coordinates | 4069005..4069295 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ429_RS19240 (OZ429_19240) | 4064472..4065113 | + | 642 | WP_269123908.1 | restriction endonuclease | - |
OZ429_RS19245 (OZ429_19245) | 4065229..4066185 | + | 957 | WP_269123910.1 | IS30 family transposase | - |
OZ429_RS19250 (OZ429_19250) | 4066197..4067102 | - | 906 | WP_269123912.1 | hypothetical protein | - |
OZ429_RS19255 (OZ429_19255) | 4067165..4067692 | - | 528 | WP_269123914.1 | hypothetical protein | - |
OZ429_RS19260 (OZ429_19260) | 4068132..4068464 | + | 333 | WP_208588210.1 | hypothetical protein | - |
OZ429_RS19265 (OZ429_19265) | 4068624..4068814 | + | 191 | Protein_3618 | hypothetical protein | - |
OZ429_RS19270 (OZ429_19270) | 4069005..4069295 | - | 291 | WP_064507888.1 | HigA family addiction module antitoxin | Antitoxin |
OZ429_RS19275 (OZ429_19275) | 4069314..4069595 | - | 282 | WP_016902142.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZ429_RS19280 (OZ429_19280) | 4070057..4072192 | - | 2136 | WP_269123922.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4065229..4066185 | 956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11064.75 Da Isoelectric Point: 9.7972
>T266326 WP_016902142.1 NZ_CP114134:c4069595-4069314 [Xanthomonas fragariae]
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N7V9W3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1A9MEX2 |