Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4368148..4368560 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | N0F11_RS21875 | Protein ID | WP_000132630.1 |
Coordinates | 4368219..4368560 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4368148..4368224 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS21865 (4364775) | 4364775..4366244 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
N0F11_RS21870 (4366244) | 4366244..4367998 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_13 | - | Antitoxin |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_13 | - | Antitoxin |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_13 | - | Antitoxin |
- (4368148) | 4368148..4368224 | - | 77 | NuclAT_13 | - | Antitoxin |
N0F11_RS21875 (4368219) | 4368219..4368560 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
N0F11_RS21880 (4368607) | 4368607..4369770 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
N0F11_RS21885 (4369818) | 4369818..4370699 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
N0F11_RS21890 (4370842) | 4370842..4370994 | - | 153 | WP_001418365.1 | hypothetical protein | - |
N0F11_RS21895 (4371137) | 4371137..4372549 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 4360347..4381580 | 21233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T266312 WP_000132630.1 NZ_CP114130:4368219-4368560 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT266312 NZ_CP114130:c4368224-4368148 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|