Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4014294..4014988 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | C3TNX7 |
Locus tag | N0F11_RS20255 | Protein ID | WP_001263495.1 |
Coordinates | 4014294..4014692 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | N0F11_RS20260 | Protein ID | WP_000554757.1 |
Coordinates | 4014695..4014988 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (4009881) | 4009881..4009961 | - | 81 | NuclAT_9 | - | - |
- (4009881) | 4009881..4009961 | - | 81 | NuclAT_9 | - | - |
- (4009881) | 4009881..4009961 | - | 81 | NuclAT_9 | - | - |
- (4009881) | 4009881..4009961 | - | 81 | NuclAT_9 | - | - |
N0F11_RS20230 (4010557) | 4010557..4011015 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
N0F11_RS20235 (4011276) | 4011276..4012733 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
N0F11_RS20240 (4012790) | 4012790..4013311 | - | 522 | Protein_3971 | peptide chain release factor H | - |
N0F11_RS20245 (4013310) | 4013310..4013513 | - | 204 | Protein_3972 | RtcB family protein | - |
N0F11_RS20250 (4013832) | 4013832..4014284 | - | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
N0F11_RS20255 (4014294) | 4014294..4014692 | - | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N0F11_RS20260 (4014695) | 4014695..4014988 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N0F11_RS20265 (4015040) | 4015040..4016095 | - | 1056 | WP_001226186.1 | DNA polymerase IV | - |
N0F11_RS20270 (4016166) | 4016166..4016951 | - | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
N0F11_RS20275 (4016923) | 4016923..4018629 | + | 1707 | Protein_3978 | flagellar biosynthesis protein FlhA | - |
N0F11_RS20280 (4018780) | 4018780..4019277 | - | 498 | Protein_3979 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T266310 WP_001263495.1 NZ_CP114130:c4014692-4014294 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|