Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3099890..3100115 | Replicon | chromosome |
| Accession | NZ_CP114130 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | N0F11_RS15905 | Protein ID | WP_000813263.1 |
| Coordinates | 3099890..3100045 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3100057..3100115 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS15870 | 3095344..3096057 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| N0F11_RS15875 | 3096195..3096391 | - | 197 | Protein_3114 | TrmB family transcriptional regulator | - |
| N0F11_RS15880 | 3096678..3097496 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| N0F11_RS15885 | 3097648..3098019 | - | 372 | WP_000090264.1 | antiterminator Q family protein | - |
| N0F11_RS15890 | 3098009..3098380 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N0F11_RS15895 | 3098393..3099442 | - | 1050 | WP_021497113.1 | DUF968 domain-containing protein | - |
| N0F11_RS15900 | 3099444..3099722 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| N0F11_RS15905 | 3099890..3100045 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3100057..3100115 | + | 59 | - | - | Antitoxin |
| N0F11_RS15910 | 3100650..3101423 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| N0F11_RS15915 | 3101775..3102188 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| N0F11_RS15920 | 3102204..3102974 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| N0F11_RS15925 | 3102996..3103742 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| N0F11_RS15930 | 3103749..3104840 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T266306 WP_000813263.1 NZ_CP114130:c3100045-3099890 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT266306 NZ_CP114130:3100057-3100115 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|