Detailed information of TA system TA266301

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2227483..2227708
• Replicon: chromosome
• Accession: NZ_CP114130
• Organism: Escherichia coli strain NJS001

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: -
• Locus tag: N0F11_RS11075
• Protein ID: WP_000813255.1
• Coordinates: 2227553..2227708 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2227483..2227541 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N0F11_RS11035	2222978..2223253	+	276	WP_000171140.1	YdaS family helix-turn-helix protein	-
N0F11_RS11040	2223237..2223658	+	422	Protein_2161	toxin YdaT family protein	-
N0F11_RS11045	2223736..2224524	+	789	WP_001489122.1	hypothetical protein	-
N0F11_RS11050	2224531..2225277	+	747	WP_000788984.1	ATP-binding protein	-
N0F11_RS11055	2225300..2226061	+	762	WP_176225815.1	DUF1627 domain-containing protein	-
N0F11_RS11060	2226077..2226508	+	432	WP_176225814.1	DUF977 family protein	-
N0F11_RS11065	2226495..2226746	+	252	WP_250844898.1	hypothetical protein	-
N0F11_RS11070	2226945..2227283	+	339	WP_152917776.1	hypothetical protein	-
-	2227483..2227541	-	59	-	-	Antitoxin
N0F11_RS11075	2227553..2227708	+	156	WP_000813255.1	type I toxin-antitoxin system toxin HokD	Toxin
N0F11_RS11080	2227962..2228039	+	78	Protein_2169	hypothetical protein	-
N0F11_RS11085	2228195..2228794	+	600	WP_176225812.1	DUF1367 family protein	-
N0F11_RS11090	2228794..2229084	+	291	WP_176225811.1	DUF1364 domain-containing protein	-
N0F11_RS11095	2229081..2229623	+	543	WP_000640110.1	DUF1133 family protein	-
N0F11_RS11105	2229950..2230084	-	135	Protein_2173	hypothetical protein	-
N0F11_RS11110	2230325..2232271	+	1947	WP_269134735.1	DUF1737 domain-containing protein	-
N0F11_RS11115	2232409..2232588	+	180	WP_000143458.1	DUF1378 family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2215570..2256470	40900

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5726.85 Da
• Isoelectric Point: 6.1531

>T266301 WP_000813255.1 NZ_CP114130:2227553-2227708 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT266301 NZ_CP114130:c2227541-2227483 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Structures

Antitoxin