Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2217126..2217497 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | A0A891STD1 |
Locus tag | N0F11_RS10995 | Protein ID | WP_042853000.1 |
Coordinates | 2217303..2217497 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2217126..2217304 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS10965 (2212878) | 2212878..2213048 | + | 171 | WP_001625136.1 | protein YnaL | - |
N0F11_RS10970 (2213081) | 2213081..2214454 | + | 1374 | WP_000123746.1 | ATP-dependent RNA helicase DbpA | - |
N0F11_RS10975 (2214583) | 2214583..2215518 | - | 936 | WP_001157382.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
N0F11_RS10980 (2215570) | 2215570..2216805 | - | 1236 | WP_000040845.1 | site-specific integrase | - |
N0F11_RS10985 (2216807) | 2216807..2217022 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2217126) | 2217126..2217304 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2217126) | 2217126..2217304 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2217126) | 2217126..2217304 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2217126) | 2217126..2217304 | + | 179 | NuclAT_0 | - | Antitoxin |
N0F11_RS10990 (2217122) | 2217122..2217310 | - | 189 | WP_001356607.1 | DUF1187 family protein | - |
N0F11_RS10995 (2217303) | 2217303..2217497 | - | 195 | WP_042853000.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
N0F11_RS11000 (2217554) | 2217554..2218363 | - | 810 | WP_000166315.1 | recombination protein RecT | - |
N0F11_RS11005 (2218356) | 2218356..2220983 | - | 2628 | WP_032324100.1 | exodeoxyribonuclease VIII | - |
N0F11_RS11010 (2221064) | 2221064..2221234 | - | 171 | WP_001427414.1 | YdaE family protein | - |
N0F11_RS11015 (2221234) | 2221234..2221455 | - | 222 | WP_000560218.1 | killing protein KilR | - |
N0F11_RS11020 (2221876) | 2221876..2222028 | - | 153 | WP_001169150.1 | DUF1391 family protein | - |
N0F11_RS11025 (2222039) | 2222039..2222173 | - | 135 | WP_000233806.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2215570..2256470 | 40900 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7019.87 Da Isoelectric Point: 8.6419
>T266298 WP_042853000.1 NZ_CP114130:c2217497-2217303 [Escherichia coli]
MRYDDVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDDVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT266298 NZ_CP114130:2217126-2217304 [Escherichia coli]
GAGGACAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGACACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAATTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCTTTTT
CAATAGTGGCAGTTATTTT
GAGGACAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGACACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAATTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCTTTTT
CAATAGTGGCAGTTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|