Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 695870..696597 | Replicon | chromosome |
| Accession | NZ_CP114130 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | N0F11_RS03475 | Protein ID | WP_000550189.1 |
| Coordinates | 695870..696184 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N0F11_RS03480 | Protein ID | WP_000560249.1 |
| Coordinates | 696181..696597 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS03455 (692028) | 692028..693014 | - | 987 | WP_000617675.1 | Gfo/Idh/MocA family oxidoreductase | - |
| N0F11_RS03460 (693093) | 693093..693785 | - | 693 | WP_000942543.1 | vancomycin high temperature exclusion protein | - |
| N0F11_RS03465 (693862) | 693862..694365 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| N0F11_RS03470 (694450) | 694450..695586 | + | 1137 | WP_000018678.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| N0F11_RS03475 (695870) | 695870..696184 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| N0F11_RS03480 (696181) | 696181..696597 | + | 417 | WP_000560249.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| N0F11_RS03485 (696642) | 696642..698660 | - | 2019 | WP_000121479.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| N0F11_RS03490 (699186) | 699186..701537 | - | 2352 | WP_000695517.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T266291 WP_000550189.1 NZ_CP114130:695870-696184 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15016.48 Da Isoelectric Point: 4.5805
>AT266291 WP_000560249.1 NZ_CP114130:696181-696597 [Escherichia coli]
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|