Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 652920..653719 | Replicon | chromosome |
Accession | NZ_CP114130 | ||
Organism | Escherichia coli strain NJS001 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | N0F11_RS03250 | Protein ID | WP_000347273.1 |
Coordinates | 652920..653384 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | C3ST72 |
Locus tag | N0F11_RS03255 | Protein ID | WP_001302819.1 |
Coordinates | 653384..653719 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0F11_RS03220 (647921) | 647921..648355 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
N0F11_RS03225 (648373) | 648373..649251 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N0F11_RS03230 (649241) | 649241..650020 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N0F11_RS03235 (650031) | 650031..650504 | - | 474 | WP_001301475.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N0F11_RS03240 (650527) | 650527..651807 | - | 1281 | WP_000681927.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N0F11_RS03245 (652056) | 652056..652865 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N0F11_RS03250 (652920) | 652920..653384 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N0F11_RS03255 (653384) | 653384..653719 | - | 336 | WP_001302819.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N0F11_RS03260 (653868) | 653868..655439 | - | 1572 | WP_001273776.1 | galactarate dehydratase | - |
N0F11_RS03265 (655814) | 655814..657148 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N0F11_RS03270 (657164) | 657164..657934 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T266290 WP_000347273.1 NZ_CP114130:c653384-652920 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|