Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 227610..227831 | Replicon | chromosome |
| Accession | NZ_CP114130 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | N0F11_RS01125 | Protein ID | WP_001295224.1 |
| Coordinates | 227724..227831 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 227610..227675 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS01105 (223050) | 223050..223952 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| N0F11_RS01110 (223963) | 223963..224946 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| N0F11_RS01115 (224943) | 224943..225947 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| N0F11_RS01120 (225977) | 225977..227248 | - | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
| - (227610) | 227610..227675 | - | 66 | NuclAT_14 | - | Antitoxin |
| - (227610) | 227610..227675 | - | 66 | NuclAT_14 | - | Antitoxin |
| - (227610) | 227610..227675 | - | 66 | NuclAT_14 | - | Antitoxin |
| - (227610) | 227610..227675 | - | 66 | NuclAT_14 | - | Antitoxin |
| - (227610) | 227610..227675 | - | 66 | NuclAT_19 | - | Antitoxin |
| - (227610) | 227610..227675 | - | 66 | NuclAT_19 | - | Antitoxin |
| - (227610) | 227610..227675 | - | 66 | NuclAT_19 | - | Antitoxin |
| - (227610) | 227610..227675 | - | 66 | NuclAT_19 | - | Antitoxin |
| N0F11_RS01125 (227724) | 227724..227831 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| N0F11_RS01130 (227918) | 227918..229597 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| N0F11_RS01135 (229594) | 229594..229785 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| N0F11_RS01140 (229782) | 229782..231353 | - | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| N0F11_RS01145 (231626) | 231626..231814 | + | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
| N0F11_RS01150 (231826) | 231826..232578 | + | 753 | Protein_227 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T266286 WP_001295224.1 NZ_CP114130:227724-227831 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 66 bp
>AT266286 NZ_CP114130:c227675-227610 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
