Detailed information of TA system TA266274

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2126084..2126309
• Replicon: chromosome
• Accession: NZ_CP114128
• Organism: Escherichia coli strain PE164

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: A0A1Q4PF16
• Locus tag: LZG51_RS10235
• Protein ID: WP_000813258.1
• Coordinates: 2126154..2126309 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2126084..2126142 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LZG51_RS10195	2121511..2122566	+	1056	Protein_1990	phage replisome organizer	-
LZG51_RS10200	2122588..2123334	+	747	WP_000788759.1	ATP-binding protein	-
LZG51_RS10205	2123356..2124117	+	762	WP_000451006.1	DUF1627 domain-containing protein	-
LZG51_RS10210	2124150..2124431	+	282	WP_233708356.1	DNA-binding protein	-
LZG51_RS10215	2124428..2124655	+	228	WP_000699809.1	hypothetical protein	-
LZG51_RS10220	2124648..2124958	+	311	Protein_1995	hypothetical protein	-
LZG51_RS10225	2125086..2125304	+	219	WP_000683607.1	DUF4014 family protein	-
LZG51_RS10230	2125306..2125863	+	558	WP_000104474.1	DUF551 domain-containing protein	-
-	2126084..2126142	-	59	-	-	Antitoxin
LZG51_RS10235	2126154..2126309	+	156	WP_000813258.1	Hok/Gef family protein	Toxin
LZG51_RS10240	2126429..2126773	+	345	WP_000756596.1	YgiW/YdeI family stress tolerance OB fold protein	-
LZG51_RS10245	2126895..2127167	+	273	WP_000191872.1	hypothetical protein	-
LZG51_RS10250	2127169..2128218	+	1050	WP_001265233.1	DUF968 domain-containing protein	-
LZG51_RS10255	2128231..2128605	+	375	WP_001217416.1	RusA family crossover junction endodeoxyribonuclease	-
LZG51_RS10260	2128602..2129423	+	822	WP_000762928.1	antitermination protein	-
LZG51_RS10275	2129989..2130420	+	432	WP_207184260.1	tellurite resistance TerB family protein	-
LZG51_RS10280	2130417..2130584	+	168	WP_000216636.1	DUF3927 family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	espW / espM2	2106724..2168988	62264

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5767.95 Da
• Isoelectric Point: 7.7942

>T266274 WP_000813258.1 NZ_CP114128:2126154-2126309 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT266274 NZ_CP114128:c2126142-2126084 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Structures

Toxin

• AlphaFold DB: A0A1Q4PF16

Antitoxin