Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1893579..1893804 | Replicon | chromosome |
| Accession | NZ_CP114128 | ||
| Organism | Escherichia coli strain PE164 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | LZG51_RS09025 | Protein ID | WP_000813255.1 |
| Coordinates | 1893649..1893804 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1893579..1893637 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZG51_RS09000 | 1888650..1889615 | + | 966 | WP_000054501.1 | hypothetical protein | - |
| LZG51_RS09005 | 1889656..1890078 | + | 423 | WP_001151251.1 | DUF977 family protein | - |
| LZG51_RS09010 | 1890331..1891230 | + | 900 | WP_000566848.1 | SMEK domain-containing protein | - |
| LZG51_RS09015 | 1891545..1892198 | - | 654 | WP_001373963.1 | class I SAM-dependent methyltransferase | - |
| LZG51_RS09020 | 1892211..1892906 | - | 696 | WP_000892866.1 | hypothetical protein | - |
| - | 1893579..1893637 | - | 59 | - | - | Antitoxin |
| LZG51_RS09025 | 1893649..1893804 | + | 156 | WP_000813255.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| LZG51_RS09030 | 1894022..1894285 | + | 264 | WP_000975572.1 | hypothetical protein | - |
| LZG51_RS09035 | 1894352..1894630 | + | 279 | WP_001360223.1 | hypothetical protein | - |
| LZG51_RS09040 | 1894632..1895681 | + | 1050 | WP_001265301.1 | DUF968 domain-containing protein | - |
| LZG51_RS09045 | 1895694..1896053 | + | 360 | WP_001217464.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LZG51_RS09050 | 1896050..1896739 | + | 690 | WP_001064889.1 | bacteriophage antitermination protein Q | - |
| LZG51_RS09070 | 1897373..1897801 | + | 429 | Protein_1767 | tellurite resistance TerB family protein | - |
| LZG51_RS09075 | 1897798..1897965 | + | 168 | WP_000216649.1 | DUF3927 family protein | - |
| LZG51_RS09080 | 1898160..1898303 | - | 144 | Protein_1769 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1851773..1927672 | 75899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5726.85 Da Isoelectric Point: 6.1531
>T266273 WP_000813255.1 NZ_CP114128:1893649-1893804 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT266273 NZ_CP114128:c1893637-1893579 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|