Detailed information of TA system TA266273

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 1893579..1893804
• Replicon: chromosome
• Accession: NZ_CP114128
• Organism: Escherichia coli strain PE164

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: -
• Locus tag: LZG51_RS09025
• Protein ID: WP_000813255.1
• Coordinates: 1893649..1893804 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	1893579..1893637 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LZG51_RS09000	1888650..1889615	+	966	WP_000054501.1	hypothetical protein	-
LZG51_RS09005	1889656..1890078	+	423	WP_001151251.1	DUF977 family protein	-
LZG51_RS09010	1890331..1891230	+	900	WP_000566848.1	SMEK domain-containing protein	-
LZG51_RS09015	1891545..1892198	-	654	WP_001373963.1	class I SAM-dependent methyltransferase	-
LZG51_RS09020	1892211..1892906	-	696	WP_000892866.1	hypothetical protein	-
-	1893579..1893637	-	59	-	-	Antitoxin
LZG51_RS09025	1893649..1893804	+	156	WP_000813255.1	type I toxin-antitoxin system toxin HokD	Toxin
LZG51_RS09030	1894022..1894285	+	264	WP_000975572.1	hypothetical protein	-
LZG51_RS09035	1894352..1894630	+	279	WP_001360223.1	hypothetical protein	-
LZG51_RS09040	1894632..1895681	+	1050	WP_001265301.1	DUF968 domain-containing protein	-
LZG51_RS09045	1895694..1896053	+	360	WP_001217464.1	RusA family crossover junction endodeoxyribonuclease	-
LZG51_RS09050	1896050..1896739	+	690	WP_001064889.1	bacteriophage antitermination protein Q	-
LZG51_RS09070	1897373..1897801	+	429	Protein_1767	tellurite resistance TerB family protein	-
LZG51_RS09075	1897798..1897965	+	168	WP_000216649.1	DUF3927 family protein	-
LZG51_RS09080	1898160..1898303	-	144	Protein_1769	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	1851773..1927672	75899

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5726.85 Da
• Isoelectric Point: 6.1531

>T266273 WP_000813255.1 NZ_CP114128:1893649-1893804 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT266273 NZ_CP114128:c1893637-1893579 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA

Structures

Antitoxin