Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 604974..605773 | Replicon | chromosome |
Accession | NZ_CP114128 | ||
Organism | Escherichia coli strain PE164 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | LZG51_RS02915 | Protein ID | WP_048969505.1 |
Coordinates | 604974..605438 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | LZG51_RS02920 | Protein ID | WP_001307405.1 |
Coordinates | 605438..605773 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LZG51_RS02885 (599975) | 599975..600409 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
LZG51_RS02890 (600427) | 600427..601305 | - | 879 | WP_137505491.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LZG51_RS02895 (601295) | 601295..602074 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LZG51_RS02900 (602085) | 602085..602558 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LZG51_RS02905 (602581) | 602581..603861 | - | 1281 | WP_233708274.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LZG51_RS02910 (604110) | 604110..604919 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LZG51_RS02915 (604974) | 604974..605438 | - | 465 | WP_048969505.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LZG51_RS02920 (605438) | 605438..605773 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LZG51_RS02925 (605922) | 605922..607493 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
LZG51_RS02930 (607868) | 607868..609202 | + | 1335 | WP_000599633.1 | galactarate/glucarate/glycerate transporter GarP | - |
LZG51_RS02935 (609218) | 609218..609988 | + | 771 | WP_024250085.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17862.33 Da Isoelectric Point: 9.6924
>T266268 WP_048969505.1 NZ_CP114128:c605438-604974 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFIKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFIKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|