Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4431705..4432359 | Replicon | chromosome |
Accession | NZ_CP114115 | ||
Organism | Pseudomonas sp. GXZC |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7Y8KJA9 |
Locus tag | OZ428_RS20720 | Protein ID | WP_038850296.1 |
Coordinates | 4431705..4432055 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W2E036 |
Locus tag | OZ428_RS20725 | Protein ID | WP_033896843.1 |
Coordinates | 4432045..4432359 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ428_RS20710 (OZ428_20710) | 4428463..4429995 | + | 1533 | WP_269131123.1 | NADH-quinone oxidoreductase subunit M | - |
OZ428_RS20715 (OZ428_20715) | 4430003..4431466 | + | 1464 | WP_105698607.1 | NADH-quinone oxidoreductase subunit NuoN | - |
OZ428_RS20720 (OZ428_20720) | 4431705..4432055 | + | 351 | WP_038850296.1 | toxin | Toxin |
OZ428_RS20725 (OZ428_20725) | 4432045..4432359 | + | 315 | WP_033896843.1 | XRE family transcriptional regulator | Antitoxin |
OZ428_RS20730 (OZ428_20730) | 4432395..4432940 | - | 546 | WP_269131124.1 | type VI secretion system-associated protein TagF | - |
OZ428_RS20735 (OZ428_20735) | 4432950..4436513 | - | 3564 | WP_269131125.1 | type VI secretion system membrane subunit TssM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13772.64 Da Isoelectric Point: 9.3833
>T266260 WP_038850296.1 NZ_CP114115:4431705-4432055 [Pseudomonas sp. GXZC]
MDALFIELPAFERHRKDYLSDELFQGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQDDLTPQHKKALKHLLDREIKARTHHET
MDALFIELPAFERHRKDYLSDELFQGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQDDLTPQHKKALKHLLDREIKARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Y8KJA9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Y8KJ45 |