Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 4273982..4274586 | Replicon | chromosome |
Accession | NZ_CP114115 | ||
Organism | Pseudomonas sp. GXZC |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OZ428_RS19810 | Protein ID | WP_269131014.1 |
Coordinates | 4273982..4274296 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OZ428_RS19815 | Protein ID | WP_177111810.1 |
Coordinates | 4274299..4274586 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ428_RS19790 (OZ428_19790) | 4270514..4271185 | + | 672 | WP_269131011.1 | response regulator transcription factor | - |
OZ428_RS19795 (OZ428_19795) | 4271267..4271635 | + | 369 | WP_269131012.1 | response regulator | - |
OZ428_RS19800 (OZ428_19800) | 4271769..4272968 | + | 1200 | WP_269131013.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OZ428_RS19805 (OZ428_19805) | 4273041..4273742 | - | 702 | WP_206542892.1 | aquaporin Z | - |
OZ428_RS19810 (OZ428_19810) | 4273982..4274296 | + | 315 | WP_269131014.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZ428_RS19815 (OZ428_19815) | 4274299..4274586 | + | 288 | WP_177111810.1 | NadS family protein | Antitoxin |
OZ428_RS19820 (OZ428_19820) | 4274616..4275800 | - | 1185 | WP_269131015.1 | sugar transporter | - |
OZ428_RS19825 (OZ428_19825) | 4275924..4276283 | - | 360 | WP_269131016.1 | type 1 fimbrial protein | - |
OZ428_RS19830 (OZ428_19830) | 4276370..4277368 | - | 999 | WP_038846999.1 | bile acid:sodium symporter family protein | - |
OZ428_RS19835 (OZ428_19835) | 4277455..4278243 | + | 789 | WP_269131017.1 | helix-turn-helix transcriptional regulator | - |
OZ428_RS19840 (OZ428_19840) | 4278240..4279475 | - | 1236 | WP_269131018.1 | Zn-dependent hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11786.71 Da Isoelectric Point: 10.2649
>T266258 WP_269131014.1 NZ_CP114115:4273982-4274296 [Pseudomonas sp. GXZC]
MIFIETPIFTRRVTELMNHDTYLSLQVALMVNPSAGDVIEGTGGIRKIRVASKGHGKRGGARVIYYHFVTASKIALLMIY
SKNEQQDLTNDERKALKAVIEHWR
MIFIETPIFTRRVTELMNHDTYLSLQVALMVNPSAGDVIEGTGGIRKIRVASKGHGKRGGARVIYYHFVTASKIALLMIY
SKNEQQDLTNDERKALKAVIEHWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|