Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3858204..3858910 | Replicon | chromosome |
| Accession | NZ_CP114058 | ||
| Organism | Rouxiella chamberiensis strain DSM 28324 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | O1V66_RS17945 | Protein ID | WP_045048776.1 |
| Coordinates | 3858204..3858608 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | O1V66_RS17950 | Protein ID | WP_045048775.1 |
| Coordinates | 3858605..3858910 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1V66_RS17920 (O1V66_17920) | 3854342..3854941 | - | 600 | WP_045048780.1 | HD domain-containing protein | - |
| O1V66_RS17925 (O1V66_17925) | 3855072..3855545 | + | 474 | WP_269127943.1 | MarR family transcriptional regulator | - |
| O1V66_RS17930 (O1V66_17930) | 3855679..3856104 | + | 426 | WP_045048778.1 | organic hydroperoxide resistance protein | - |
| O1V66_RS17935 (O1V66_17935) | 3856259..3857944 | + | 1686 | WP_045048777.1 | kdo(2)-lipid A phosphoethanolamine 7''-transferase | - |
| O1V66_RS17945 (O1V66_17945) | 3858204..3858608 | - | 405 | WP_045048776.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| O1V66_RS17950 (O1V66_17950) | 3858605..3858910 | - | 306 | WP_045048775.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| O1V66_RS17955 (O1V66_17955) | 3859160..3859450 | + | 291 | WP_045048774.1 | muconolactone Delta-isomerase | - |
| O1V66_RS17960 (O1V66_17960) | 3859514..3859939 | - | 426 | WP_045048773.1 | VOC family protein | - |
| O1V66_RS17965 (O1V66_17965) | 3860088..3860975 | + | 888 | WP_045048772.1 | LysR family transcriptional regulator | - |
| O1V66_RS17970 (O1V66_17970) | 3860972..3862489 | - | 1518 | WP_269128364.1 | FAD-dependent oxidoreductase | - |
| O1V66_RS17975 (O1V66_17975) | 3862620..3863534 | - | 915 | WP_045048770.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15746.02 Da Isoelectric Point: 10.0285
>T266236 WP_045048776.1 NZ_CP114058:c3858608-3858204 [Rouxiella chamberiensis]
MSPRVFTSKALRQQLKQEELANLVGDFKSYKASGFPPETFGRDAPYDDERTWPLVRQEEVSHIHLADASTVWHRNILQYR
RTSNKSHLVYCKGSMHNDVFLLIILLQPDAHKMHRDPRHMEKIGLMAQAFRNRF
MSPRVFTSKALRQQLKQEELANLVGDFKSYKASGFPPETFGRDAPYDDERTWPLVRQEEVSHIHLADASTVWHRNILQYR
RTSNKSHLVYCKGSMHNDVFLLIILLQPDAHKMHRDPRHMEKIGLMAQAFRNRF
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|