Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 4013986..4014581 | Replicon | chromosome |
Accession | NZ_CP113974 | ||
Organism | Pseudomonas aeruginosa strain M6A146 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | OZ175_RS18925 | Protein ID | WP_003113526.1 |
Coordinates | 4014303..4014581 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OZ175_RS18920 | Protein ID | WP_003113527.1 |
Coordinates | 4013986..4014291 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ175_RS18900 (OZ175_18900) | 4009461..4009796 | + | 336 | WP_031633682.1 | hypothetical protein | - |
OZ175_RS18905 (OZ175_18905) | 4010328..4012094 | - | 1767 | WP_023087829.1 | anti-phage dCTP deaminase | - |
OZ175_RS18910 (OZ175_18910) | 4012351..4013013 | - | 663 | WP_023087830.1 | restriction endonuclease | - |
OZ175_RS18915 (OZ175_18915) | 4013237..4013650 | - | 414 | WP_049231965.1 | hypothetical protein | - |
OZ175_RS18920 (OZ175_18920) | 4013986..4014291 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
OZ175_RS18925 (OZ175_18925) | 4014303..4014581 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZ175_RS18930 (OZ175_18930) | 4014634..4014762 | - | 129 | Protein_3737 | integrase | - |
OZ175_RS18935 (OZ175_18935) | 4014910..4017138 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
OZ175_RS18940 (OZ175_18940) | 4017208..4017855 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
OZ175_RS18945 (OZ175_18945) | 4017917..4019155 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T266205 WP_003113526.1 NZ_CP113974:c4014581-4014303 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|