Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) prlF-yhaV (relBE)/YhaV-PrlF
Location 1045345..1046120 Replicon chromosome
Accession NZ_CP113974
Organism Pseudomonas aeruginosa strain M6A146

Toxin (Protein)


Gene name yhaV Uniprot ID V6ADY6
Locus tag OZ175_RS05150 Protein ID WP_009518525.1
Coordinates 1045662..1046120 (+) Length 153 a.a.

Antitoxin (Protein)


Gene name prlF Uniprot ID A0A7M2ZSF3
Locus tag OZ175_RS05145 Protein ID WP_023087286.1
Coordinates 1045345..1045662 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZ175_RS05115 (OZ175_05115) 1040669..1041319 - 651 WP_023087281.1 isoprenylcysteine carboxylmethyltransferase family protein -
OZ175_RS05120 (OZ175_05120) 1041316..1041555 - 240 WP_023087282.1 DUF2933 domain-containing protein -
OZ175_RS05125 (OZ175_05125) 1041567..1041968 - 402 WP_023087283.1 hypothetical protein -
OZ175_RS05130 (OZ175_05130) 1042123..1042557 - 435 WP_078452152.1 hypothetical protein -
OZ175_RS05135 (OZ175_05135) 1042630..1043124 + 495 WP_031633853.1 MerR family DNA-binding protein -
OZ175_RS05140 (OZ175_05140) 1043180..1045045 - 1866 WP_023087285.1 MobH family relaxase -
OZ175_RS05145 (OZ175_05145) 1045345..1045662 + 318 WP_023087286.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
OZ175_RS05150 (OZ175_05150) 1045662..1046120 + 459 WP_009518525.1 type II toxin-antitoxin system YhaV family toxin Toxin
OZ175_RS05155 (OZ175_05155) 1046147..1046506 + 360 WP_023087287.1 DUF3742 family protein -
OZ175_RS05160 (OZ175_05160) 1046513..1048036 - 1524 WP_023087288.1 conjugal transfer protein TraG N-terminal domain-containing protein -
OZ175_RS05165 (OZ175_05165) 1048050..1048409 - 360 WP_023087289.1 hypothetical protein -
OZ175_RS05170 (OZ175_05170) 1048406..1049800 - 1395 WP_268858563.1 integrating conjugative element protein -
OZ175_RS05175 (OZ175_05175) 1049810..1050757 - 948 WP_023087291.1 TIGR03756 family integrating conjugative element protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 992049..1107265 115216


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin endonuclease, YhaV

(8-144)

Antitoxin

PrlF antitoxin

(8-100)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 17660.02 Da        Isoelectric Point: 10.1848

>T266200 WP_009518525.1 NZ_CP113974:1045662-1046120 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE

Download         Length: 459 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11156.69 Da        Isoelectric Point: 4.5685

>AT266200 WP_023087286.1 NZ_CP113974:1045345-1045662 [Pseudomonas aeruginosa]
MPAIHEVATLTSKGQITLPKPIRQALGVDAGGKLAFDLRGSEVVVTRVDAEHEDPAIGAFLSLLARDIEAGRNLQGLPED
LARAMLEHAGHGVNLDEEIDGKVEL

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V6ADY6

Antitoxin

Source ID Structure
AlphaFold DB A0A7M2ZSF3

References