Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2496142..2496326 | Replicon | chromosome |
| Accession | NC_017338 | ||
| Organism | Staphylococcus aureus subsp. aureus JKD6159 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2K4AFL5 |
| Locus tag | SAA6159_RS12615 | Protein ID | WP_000482651.1 |
| Coordinates | 2496219..2496326 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2496142..2496202 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAA6159_RS12585 | 2491686..2492801 | - | 1116 | WP_000971536.1 | pyridoxal phosphate-dependent aminotransferase family protein | - |
| SAA6159_RS12590 | 2492779..2493786 | - | 1008 | WP_001046645.1 | biotin synthase BioB | - |
| SAA6159_RS12595 | 2493788..2495146 | - | 1359 | WP_001110075.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
| SAA6159_RS12600 | 2495124..2495810 | - | 687 | WP_001217930.1 | dethiobiotin synthase | - |
| SAA6159_RS12605 | 2495865..2496032 | - | 168 | WP_044026051.1 | hypothetical protein | - |
| - | 2496142..2496202 | + | 61 | - | - | Antitoxin |
| SAA6159_RS12615 | 2496219..2496326 | - | 108 | WP_000482651.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAA6159_RS12620 | 2496460..2496846 | - | 387 | WP_000779361.1 | flippase GtxA | - |
| SAA6159_RS12625 | 2497114..2498256 | + | 1143 | WP_001176854.1 | glycerate kinase | - |
| SAA6159_RS12630 | 2498316..2498975 | + | 660 | WP_000831296.1 | hypothetical protein | - |
| SAA6159_RS12635 | 2499158..2500369 | + | 1212 | WP_001191924.1 | multidrug effflux MFS transporter | - |
| SAA6159_RS12640 | 2500492..2500965 | - | 474 | WP_000456494.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3984.75 Da Isoelectric Point: 11.0582
>T26620 WP_000482651.1 NC_017338:c2496326-2496219 [Staphylococcus aureus subsp. aureus JKD6159]
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
Download Length: 108 bp
>T26620 NC_017338:c2496326-2496219 [Staphylococcus aureus subsp. aureus JKD6159]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT26620 NC_017338:2496142-2496202 [Staphylococcus aureus subsp. aureus JKD6159]
TACATAATAAATTGAACATCTAAATACACCAAGTCCCCTCACTAGTGCAATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAGTCCCCTCACTAGTGCAATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|