Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4009898..4010531 | Replicon | chromosome |
Accession | NZ_CP113951 | ||
Organism | Rhodococcus sp. JS3073 |
Toxin (Protein)
Gene name | graT | Uniprot ID | I0WTN6 |
Locus tag | OYT95_RS18210 | Protein ID | WP_007297374.1 |
Coordinates | 4009898..4010179 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OYT95_RS18215 | Protein ID | WP_007297375.1 |
Coordinates | 4010238..4010531 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OYT95_RS18185 (OYT95_18185) | 4006677..4007117 | + | 441 | WP_255309519.1 | MerR family transcriptional regulator | - |
OYT95_RS18190 (OYT95_18190) | 4007322..4007819 | - | 498 | WP_268792127.1 | hypothetical protein | - |
OYT95_RS18195 (OYT95_18195) | 4007923..4008483 | - | 561 | WP_146777800.1 | hypothetical protein | - |
OYT95_RS18200 (OYT95_18200) | 4008757..4009314 | - | 558 | WP_268792128.1 | hypothetical protein | - |
OYT95_RS18205 (OYT95_18205) | 4009524..4009655 | + | 132 | WP_009480666.1 | hypothetical protein | - |
OYT95_RS18210 (OYT95_18210) | 4009898..4010179 | + | 282 | WP_007297374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OYT95_RS18215 (OYT95_18215) | 4010238..4010531 | + | 294 | WP_007297375.1 | HigA family addiction module antitoxin | Antitoxin |
OYT95_RS18220 (OYT95_18220) | 4010755..4011357 | + | 603 | WP_268792129.1 | recombinase family protein | - |
OYT95_RS18225 (OYT95_18225) | 4011417..4012178 | - | 762 | WP_039951252.1 | hypothetical protein | - |
OYT95_RS18230 (OYT95_18230) | 4012336..4012827 | - | 492 | WP_268792130.1 | hypothetical protein | - |
OYT95_RS18235 (OYT95_18235) | 4013162..4013458 | - | 297 | WP_005567379.1 | hypothetical protein | - |
OYT95_RS18240 (OYT95_18240) | 4013603..4014943 | + | 1341 | WP_268792131.1 | glutathione-independent formaldehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10992.48 Da Isoelectric Point: 8.9336
>T266188 WP_007297374.1 NZ_CP113951:4009898-4010179 [Rhodococcus sp. JS3073]
VIESFADKETERVFHRQFSKKLPQDIQRIARRRLLLIEAATDVNDLRVPPGNRLEKLSGDRVGQYSVRINDQYRICFIWR
ATAAYDVEITDYH
VIESFADKETERVFHRQFSKKLPQDIQRIARRRLLLIEAATDVNDLRVPPGNRLEKLSGDRVGQYSVRINDQYRICFIWR
ATAAYDVEITDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|