Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3258244..3258841 | Replicon | chromosome |
| Accession | NZ_CP113948 | ||
| Organism | Flavobacterium praedii strain IMCC34515 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | OYT91_RS13775 | Protein ID | WP_281238426.1 |
| Coordinates | 3258560..3258841 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OYT91_RS13770 | Protein ID | WP_281238425.1 |
| Coordinates | 3258244..3258546 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OYT91_RS13745 | 3254234..3255586 | + | 1353 | WP_281238420.1 | exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | - |
| OYT91_RS13750 | 3255588..3256358 | + | 771 | WP_281238421.1 | glycosyltransferase family 2 protein | - |
| OYT91_RS13755 | 3256363..3256746 | - | 384 | WP_281238422.1 | ORF6N domain-containing protein | - |
| OYT91_RS13760 | 3256754..3256891 | - | 138 | WP_281238423.1 | ORF6N domain-containing protein | - |
| OYT91_RS13765 | 3256933..3258243 | - | 1311 | WP_281238424.1 | phenylacetate--CoA ligase family protein | - |
| OYT91_RS13770 | 3258244..3258546 | - | 303 | WP_281238425.1 | HigA family addiction module antitoxin | Antitoxin |
| OYT91_RS13775 | 3258560..3258841 | - | 282 | WP_281238426.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OYT91_RS13780 | 3258956..3260230 | + | 1275 | WP_281238427.1 | phosphoribosylamine--glycine ligase | - |
| OYT91_RS13785 | 3260298..3260531 | - | 234 | WP_269224320.1 | uracil phosphoribosyltransferase | - |
| OYT91_RS13790 | 3260676..3261605 | + | 930 | WP_281238428.1 | DUF6427 family protein | - |
| OYT91_RS13795 | 3261600..3262253 | - | 654 | WP_269224317.1 | uracil phosphoribosyltransferase | - |
| OYT91_RS13800 | 3262343..3262948 | + | 606 | WP_281238429.1 | DUF4254 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10956.63 Da Isoelectric Point: 10.0446
>T266187 WP_281238426.1 NZ_CP113948:c3258841-3258560 [Flavobacterium praedii]
MIISFGSKETEKIWNGIVVKKPSIEIQQISRRKLRMLNNSQDLIDLRIPPSNRLEKLSGNLKEFYSILINNQWRIIFNWE
NGNASNVEIVDYH
MIISFGSKETEKIWNGIVVKKPSIEIQQISRRKLRMLNNSQDLIDLRIPPSNRLEKLSGNLKEFYSILINNQWRIIFNWE
NGNASNVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|