Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
| Location | 1823236..1823752 | Replicon | chromosome |
| Accession | NZ_CP113946 | ||
| Organism | Lactobacillus sp. ESL0677 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | - |
| Locus tag | OZX76_RS08910 | Protein ID | WP_277179578.1 |
| Coordinates | 1823236..1823517 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | OZX76_RS08915 | Protein ID | WP_277179580.1 |
| Coordinates | 1823510..1823752 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX76_RS08880 (OZX76_08880) | 1819377..1819883 | - | 507 | WP_277179567.1 | sigma-70 family RNA polymerase sigma factor | - |
| OZX76_RS08885 (OZX76_08885) | 1820114..1820953 | - | 840 | WP_277179569.1 | hypothetical protein | - |
| OZX76_RS08890 (OZX76_08890) | 1821648..1821803 | + | 156 | WP_277179571.1 | hypothetical protein | - |
| OZX76_RS08895 (OZX76_08895) | 1822117..1822272 | + | 156 | WP_277179573.1 | hypothetical protein | - |
| OZX76_RS08900 (OZX76_08900) | 1822586..1822741 | + | 156 | WP_277179575.1 | hypothetical protein | - |
| OZX76_RS08905 (OZX76_08905) | 1822978..1823121 | - | 144 | WP_277179577.1 | hypothetical protein | - |
| OZX76_RS08910 (OZX76_08910) | 1823236..1823517 | - | 282 | WP_277179578.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZX76_RS08915 (OZX76_08915) | 1823510..1823752 | - | 243 | WP_277179580.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZX76_RS08920 (OZX76_08920) | 1823964..1824530 | - | 567 | WP_277179582.1 | hypothetical protein | - |
| OZX76_RS08925 (OZX76_08925) | 1824954..1825784 | - | 831 | WP_277179584.1 | hypothetical protein | - |
| OZX76_RS08930 (OZX76_08930) | 1825756..1826277 | - | 522 | WP_277179586.1 | hypothetical protein | - |
| OZX76_RS08935 (OZX76_08935) | 1826362..1828149 | - | 1788 | WP_277179588.1 | SLAP domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11409.16 Da Isoelectric Point: 9.9111
>T266186 WP_277179578.1 NZ_CP113946:c1823517-1823236 [Lactobacillus sp. ESL0677]
MSDFVYKPAFESQFKKHYKKMLKGSKYQAKDFERVYRKLLCNKPLEARYNDYPLINRRPERDLHIKPDWLLIYKYDGEYV
DFINTGSRSDLFK
MSDFVYKPAFESQFKKHYKKMLKGSKYQAKDFERVYRKLLCNKPLEARYNDYPLINRRPERDLHIKPDWLLIYKYDGEYV
DFINTGSRSDLFK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|