Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 1125073..1125604 | Replicon | chromosome |
Accession | NZ_CP113939 | ||
Organism | Bifidobacterium sp. ESL0690 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | OZX62_RS04510 | Protein ID | WP_277176830.1 |
Coordinates | 1125314..1125604 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | OZX62_RS04505 | Protein ID | WP_277176829.1 |
Coordinates | 1125073..1125333 (+) | Length | 87 a.a. |
Genomic Context
Location: 1120462..1121658 (1197 bp)
Type: Others
Protein ID: WP_277176825.1
Type: Others
Protein ID: WP_277176825.1
Location: 1122305..1124197 (1893 bp)
Type: Others
Protein ID: WP_277176827.1
Type: Others
Protein ID: WP_277176827.1
Location: 1124299..1124991 (693 bp)
Type: Others
Protein ID: WP_277176828.1
Type: Others
Protein ID: WP_277176828.1
Location: 1125073..1125333 (261 bp)
Type: Antitoxin
Protein ID: WP_277176829.1
Type: Antitoxin
Protein ID: WP_277176829.1
Location: 1125314..1125604 (291 bp)
Type: Toxin
Protein ID: WP_277176830.1
Type: Toxin
Protein ID: WP_277176830.1
Location: 1121787..1122047 (261 bp)
Type: Others
Protein ID: WP_277176826.1
Type: Others
Protein ID: WP_277176826.1
Location: 1125622..1126926 (1305 bp)
Type: Others
Protein ID: WP_277176831.1
Type: Others
Protein ID: WP_277176831.1
Location: 1127104..1127514 (411 bp)
Type: Others
Protein ID: WP_277176832.1
Type: Others
Protein ID: WP_277176832.1
Location: 1127574..1129271 (1698 bp)
Type: Others
Protein ID: WP_277176833.1
Type: Others
Protein ID: WP_277176833.1
Location: 1129389..1129622 (234 bp)
Type: Others
Protein ID: WP_277176834.1
Type: Others
Protein ID: WP_277176834.1
Location: 1129699..1130442 (744 bp)
Type: Others
Protein ID: WP_277176835.1
Type: Others
Protein ID: WP_277176835.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX62_RS04485 (OZX62_04485) | 1120462..1121658 | + | 1197 | WP_277176825.1 | type II CAAX endopeptidase family protein | - |
OZX62_RS04490 (OZX62_04490) | 1121787..1122047 | - | 261 | WP_277176826.1 | 30S ribosomal protein S20 | - |
OZX62_RS04495 (OZX62_04495) | 1122305..1124197 | + | 1893 | WP_277176827.1 | translation elongation factor 4 | - |
OZX62_RS04500 (OZX62_04500) | 1124299..1124991 | + | 693 | WP_277176828.1 | nitroreductase family protein | - |
OZX62_RS04505 (OZX62_04505) | 1125073..1125333 | + | 261 | WP_277176829.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OZX62_RS04510 (OZX62_04510) | 1125314..1125604 | + | 291 | WP_277176830.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OZX62_RS04515 (OZX62_04515) | 1125622..1126926 | - | 1305 | WP_277176831.1 | AAA family ATPase | - |
OZX62_RS04520 (OZX62_04520) | 1127104..1127514 | - | 411 | WP_277176832.1 | hypothetical protein | - |
OZX62_RS04525 (OZX62_04525) | 1127574..1129271 | - | 1698 | WP_277176833.1 | zinc-ribbon domain-containing protein | - |
OZX62_RS04530 (OZX62_04530) | 1129389..1129622 | - | 234 | WP_277176834.1 | hypothetical protein | - |
OZX62_RS04535 (OZX62_04535) | 1129699..1130442 | - | 744 | WP_277176835.1 | response regulator transcription factor | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11516.42 Da Isoelectric Point: 10.5771
>T266176 WP_277176830.1 NZ_CP113939:1125314-1125604 [Bifidobacterium sp. ESL0690]
VALQQIERTATFLRQAKQLRRKHYDFDKLEKVIRLLMAQDHEVLRRRYRDHALKGNLRNFRELHIEADWLLIYQIKGDVL
TLVLVETGSHQQLLGK
VALQQIERTATFLRQAKQLRRKHYDFDKLEKVIRLLMAQDHEVLRRRYRDHALKGNLRNFRELHIEADWLLIYQIKGDVL
TLVLVETGSHQQLLGK
Download Length: 291 bp