Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
| Location | 1125073..1125604 | Replicon | chromosome |
| Accession | NZ_CP113939 | ||
| Organism | Bifidobacterium sp. ESL0690 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | - |
| Locus tag | OZX62_RS04510 | Protein ID | WP_277176830.1 |
| Coordinates | 1125314..1125604 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | OZX62_RS04505 | Protein ID | WP_277176829.1 |
| Coordinates | 1125073..1125333 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX62_RS04485 (OZX62_04485) | 1120462..1121658 | + | 1197 | WP_277176825.1 | type II CAAX endopeptidase family protein | - |
| OZX62_RS04490 (OZX62_04490) | 1121787..1122047 | - | 261 | WP_277176826.1 | 30S ribosomal protein S20 | - |
| OZX62_RS04495 (OZX62_04495) | 1122305..1124197 | + | 1893 | WP_277176827.1 | translation elongation factor 4 | - |
| OZX62_RS04500 (OZX62_04500) | 1124299..1124991 | + | 693 | WP_277176828.1 | nitroreductase family protein | - |
| OZX62_RS04505 (OZX62_04505) | 1125073..1125333 | + | 261 | WP_277176829.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZX62_RS04510 (OZX62_04510) | 1125314..1125604 | + | 291 | WP_277176830.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZX62_RS04515 (OZX62_04515) | 1125622..1126926 | - | 1305 | WP_277176831.1 | AAA family ATPase | - |
| OZX62_RS04520 (OZX62_04520) | 1127104..1127514 | - | 411 | WP_277176832.1 | hypothetical protein | - |
| OZX62_RS04525 (OZX62_04525) | 1127574..1129271 | - | 1698 | WP_277176833.1 | zinc-ribbon domain-containing protein | - |
| OZX62_RS04530 (OZX62_04530) | 1129389..1129622 | - | 234 | WP_277176834.1 | hypothetical protein | - |
| OZX62_RS04535 (OZX62_04535) | 1129699..1130442 | - | 744 | WP_277176835.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11516.42 Da Isoelectric Point: 10.5771
>T266176 WP_277176830.1 NZ_CP113939:1125314-1125604 [Bifidobacterium sp. ESL0690]
VALQQIERTATFLRQAKQLRRKHYDFDKLEKVIRLLMAQDHEVLRRRYRDHALKGNLRNFRELHIEADWLLIYQIKGDVL
TLVLVETGSHQQLLGK
VALQQIERTATFLRQAKQLRRKHYDFDKLEKVIRLLMAQDHEVLRRRYRDHALKGNLRNFRELHIEADWLLIYQIKGDVL
TLVLVETGSHQQLLGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|