Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 165390..165913 | Replicon | chromosome |
Accession | NZ_CP113929 | ||
Organism | Bifidobacterium sp. ESL0704 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | OZX64_RS00530 | Protein ID | WP_277173016.1 |
Coordinates | 165650..165913 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | OZX64_RS00525 | Protein ID | WP_277156667.1 |
Coordinates | 165390..165653 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX64_RS00520 (OZX64_00520) | 164724..165164 | + | 441 | WP_277173014.1 | GNAT family N-acetyltransferase | - |
OZX64_RS00525 (OZX64_00525) | 165390..165653 | + | 264 | WP_277156667.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OZX64_RS00530 (OZX64_00530) | 165650..165913 | + | 264 | WP_277173016.1 | Txe/YoeB family addiction module toxin | Toxin |
OZX64_RS00535 (OZX64_00535) | 166383..169040 | + | 2658 | WP_277173019.1 | AAA family ATPase | - |
OZX64_RS00540 (OZX64_00540) | 169037..170599 | + | 1563 | WP_277173021.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 164724..181499 | 16775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10190.49 Da Isoelectric Point: 10.0668
>T266170 WP_277173016.1 NZ_CP113929:165650-165913 [Bifidobacterium sp. ESL0704]
VTYRVAIKNSAKTDLKKLKRSHLQQSFMQVVADLESDPYQPTQSFEKLQPASRGLYSRRINSQHRVVYDVDDRTKTVTIY
AAWSHYE
VTYRVAIKNSAKTDLKKLKRSHLQQSFMQVVADLESDPYQPTQSFEKLQPASRGLYSRRINSQHRVVYDVDDRTKTVTIY
AAWSHYE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|