Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 153905..154428 | Replicon | chromosome |
Accession | NZ_CP113914 | ||
Organism | Bifidobacterium sp. ESL0798 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | OZX74_RS00545 | Protein ID | WP_277156668.1 |
Coordinates | 154165..154428 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | OZX74_RS00540 | Protein ID | WP_277156667.1 |
Coordinates | 153905..154168 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX74_RS00530 (OZX74_00530) | 152735..153043 | + | 309 | WP_277156665.1 | GNAT family N-acetyltransferase | - |
OZX74_RS00535 (OZX74_00535) | 153258..153704 | + | 447 | WP_277156666.1 | GNAT family N-acetyltransferase | - |
OZX74_RS00540 (OZX74_00540) | 153905..154168 | + | 264 | WP_277156667.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OZX74_RS00545 (OZX74_00545) | 154165..154428 | + | 264 | WP_277156668.1 | Txe/YoeB family addiction module toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 144575..164166 | 19591 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10189.55 Da Isoelectric Point: 10.3525
>T266154 WP_277156668.1 NZ_CP113914:154165-154428 [Bifidobacterium sp. ESL0798]
VTYRVAIKNSAKTDLKKLKRSHLQQSFMQVVADLKSDPYQPTQSFEKLQPASRGLYSRRINSQHRVVYDVDDRTKTVTIY
AAWSHYE
VTYRVAIKNSAKTDLKKLKRSHLQQSFMQVVADLKSDPYQPTQSFEKLQPASRGLYSRRINSQHRVVYDVDDRTKTVTIY
AAWSHYE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|